KEGG   Methanocaldococcus jannaschii: MJ_0397Help
Entry
MJ_0397           CDS       T00003                                 

Definition
(GenBank) DNA-directed RNA polymerase, subunit E' (rpoE1)
  KO
K03049  DNA-directed RNA polymerase subunit E' [EC:2.7.7.6]
Organism
mja  Methanocaldococcus jannaschii
Pathway
mja00230  Purine metabolism
mja00240  Pyrimidine metabolism
mja01100  Metabolic pathways
mja03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:mja00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    MJ_0397
   00240 Pyrimidine metabolism
    MJ_0397
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    MJ_0397
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mja03021]
    MJ_0397
Enzymes [BR:mja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     MJ_0397
Transcription machinery [BR:mja03021]
 Prokaryotic type
  Archaeal type
   RNA polymerase
    Core subunits
     MJ_0397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SHS2_Rpb7-N S1 DUF826
Motif
Other DBs
NCBI-ProteinID: AAB98387
UniProt: Q57840
Structure
PDB: 

Position
complement(357984..358547)
Genome map
AA seq 187 aa AA seqDB search
MYKILEIADVVKVPPEEFGKDLKETVKKILMEKYEGRLDKDVGFVLSIVDVKDIGEGKVV
HGDGSAYHPVVFETLVYIPEMYELIEGEVVDVVEFGSFVRLGPLDGLIHVSQIMDDYVSY
DPKREAIIGKETGKVLEIGDYVRARIVAISLKAERKRGSKIALTMRQPYLGKLEWIEEEK
AKKQNQE
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaattttagagattgcagatgttgtaaaagttccaccagaagagtttggtaag
gatttaaaagagacagtaaaaaaaattctcatggaaaaatatgaaggaagattagataaa
gatgttggatttgttttatccattgtagatgtaaaagacattggagaaggtaaagtagtg
catggtgatggttcagcatatcatccagttgtatttgagactctcgtttatatcccagag
atgtatgaacttattgagggagaggtcgttgatgttgttgagtttggtagctttgtaagg
ttgggacctttagatggattaattcatgtttcacagattatggatgactatgtatcttac
gaccctaagagggaggcaattattggaaaagagactggaaaggttttggagattggagat
tatgttagggcaaggattgttgctataagtttgaaggcagaaagaaagagaggtagtaag
atagcattaaccatgagacagccatacttgggaaaattagagtggattgaggaggaaaaa
gctaaaaagcaaaatcaagaataa

DBGET integrated database retrieval system