KEGG   Methanocaldococcus jannaschii: MJ_0571Help
Entry
MJ_0571           CDS       T00003                                 

Definition
(GenBank) aspartate kinase (lysC)
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
mja  Methanocaldococcus jannaschii
Pathway
mja00260  Glycine, serine and threonine metabolism
mja00261  Monobactam biosynthesis
mja00270  Cysteine and methionine metabolism
mja00300  Lysine biosynthesis
mja01100  Metabolic pathways
mja01110  Biosynthesis of secondary metabolites
mja01120  Microbial metabolism in diverse environments
mja01130  Biosynthesis of antibiotics
mja01210  2-Oxocarboxylic acid metabolism
mja01230  Biosynthesis of amino acids
Module
mja_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
mja_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MJ_0571
   00270 Cysteine and methionine metabolism
    MJ_0571
   00300 Lysine biosynthesis
    MJ_0571
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    MJ_0571
Enzymes [BR:mja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     MJ_0571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ACT_7 ACT AAA_23
Motif
Other DBs
NCBI-ProteinID: AAB98565
UniProt: Q57991
Structure
PDB: 

Position
508398..509819
Genome map
AA seq 473 aa AA seqDB search
MTTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVR
DIAKVGDFIKFIREKHYKAIEEAIKSEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPK
SRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLP
LLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDP
RLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITN
DMEMSDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETN
ISLVVSEEDVDKALKALKREFGDFGKKSFLNNNLIRDVSVDKDVCVISVVGAGMRGAKGI
AGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIEKTNS
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagtaatgaagtttggaggaacttctgtaggttctggagaaagaattaggcat
gtggcgaaaatagtaacaaagagaaaaaaagaggatgatgatgtggttgttgtagtttca
gcaatgagtgaagtaactaacgcattggtggagatatctcagcaagctttagatgttaga
gatatcgcaaaagtaggagattttataaaatttattagagagaaacactacaaagctata
gaagaagctataaaatcagaagaaattaaagaagaagtaaaaaaaataattgacagcagg
attgaagaattagagaaggttttaattggtgtagcatacttaggggagcttacaccaaag
tcaagagactatatattatcatttggagagaggttgtcctcaccaatattaagtggagct
attagagatttaggagaaaagtctattgctttagaaggaggagaagcaggaataataacg
gataacaactttggaagtgcaagagttaaaagattagaggttaaagagagattgttacca
ttattaaaagagggcattattccagtggttacaggatttataggaaccactgaagagggt
tatataacaaccttaggaagaggcggaagtgattactcagccgctttaattggttatggc
ttagatgcagatattattgaaatttggacagatgtttctggagtttatacaacagaccca
agattagttcctactgcaagaagaattccaaaacttagttacatagaggctatggaatta
gcatactttggagctaaggttttgcatccaagaactatagagccagctatggagaagggc
attccaatattggtaaagaatacatttgagccagagagtgaaggaactttaataaccaac
gatatggagatgagtgatagcatagttaaagctatatcaacaataaaaaatgtcgcttta
ataaacatatttggagctgggatggttggagttagtggaacagcggcaaggatattcaaa
gctttaggagaagaggaagttaatgtaattttaataagccaaggttcctctgaaacaaat
atatccctcgttgtaagtgaggaggatgttgataaagcattaaaagcattaaagagagag
tttggggattttggaaagaagagctttttaaacaataacttaattagggatgtgagtgtt
gataaagatgtttgtgttatttcagttgtaggggctggaatgagaggagctaaaggcata
gctggaaagatattcactgctgtttctgaaagcggggcaaatataaagatgatagctcaa
ggttcatcagaagtgaatatatcatttgttattgatgaaaaggatttgttgaattgtgtt
agaaaattgcacgagaagtttattgaaaaaactaacagctaa

DBGET integrated database retrieval system