KEGG   Methanocaldococcus jannaschii: MJ_0709
Entry
MJ_0709           CDS       T00003                                 
Name
(GenBank) conserved hypothetical protein
Organism
mja  Methanocaldococcus jannaschii
SSDB
Motif
Pfam: MatE Polysacc_synt_C Polysacc_synt
Other DBs
NCBI-ProteinID: AAB98703
UniProt: Q58119
Position
635015..636367
AA seq 450 aa
MKNVEILLDDPKKAVIEVSKPIIVATFIESIYSLVDSIWVSGLGADALAAVGASFPILIS
IYAVSWGLSIGISSGIARRVGAKNKEEADKVANHAIILALIAGILYIIAVYPNLDTLFSL
MGTYGDCKSLAIKYSSILVLGTVIFTICDALYGIFRGEGNTKIVMIASVIGTLTNIILDP
IFIYMLNLGISGASYATLIAIIISLLILAYELFIKKSCYVTVKLSKFKPDLKIIADLIRV
GIPSALIEITVAVSFFIMTSIIMMVGDSRGLAVYTGALRITEFGFIPMLGLASGATSVIG
ATYGARSFEKLKTAYFYTIKIGVLMEIIIVALIMLLSPILAYLFTYTKTSMGIHEELVKA
LRIVPLYLLFTPFILTTSAMFQGIGKGEKSLIISIFRSLICHISYAYLFAVILGLGMFGI
YSGLVVGEFTAGIFAFLFGVLAIKALIKSK
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgaaaaatgttgaaatattgttggatgacccaaaaaaagcagtaattgaagtatcaaag
ccaataattgttgctacattcattgaatcaatctatagcttagttgatagtatctgggtt
tctggattgggggcagatgcattagctgctgtgggagcgagttttccaatattaattagc
atatatgcagttagttggggtttgagtattgggattagctctggaatagcaagaagagtt
ggagcaaaaaataaagaagaagctgataaagtagcaaatcatgcaattattttagcttta
attgctggaattttgtatattatagctgtatatccaaatcttgatacgctatttagctta
atgggaacctatggagattgtaagtcattagctataaaatactccagcatactggtttta
ggaactgttatatttacaatctgcgatgcgttatatgggatatttaggggggagggaaat
acaaagatagttatgatagcaagcgttataggcactttaacaaacatcatcttagacccg
atattcatctatatgctaaatttagggataagtggggcaagttatgctactttgatagct
ataattatatctctcttaattttagcttatgagctgtttataaaaaaatcatgttatgtt
acagttaaattatcaaaatttaaacctgatttaaagattatagccgatttaattagagtt
ggaattccttcagcattgatagagattactgttgcagtatcattttttataatgacttca
ataattatgatggttggagatagtagaggtttagctgtctatactggagctttaagaata
acagagtttggctttattccaatgttaggtttggcaagtggagctacttcagttatagga
gccacttacggagcaaggagttttgaaaaattaaaaacagcttatttttacacaataaaa
attggggttttaatggaaattattatagttgctttaataatgctcttatccccaatctta
gcttatctatttacttacacaaaaacctcaatgggaattcatgaagaacttgttaaagct
ttaagaatagttccattatatttactatttacaccatttattttaacaacatccgcaatg
ttccaaggaattggtaaaggagaaaaatcattaataatttccatatttaggtcgctaata
tgtcatatatcctatgcttatctatttgcagtaatattgggattaggaatgtttggaata
tatagcggcttagtggttggagaatttacagctggaatttttgcatttctatttggagtt
ttagctataaaagcattaataaaatctaaataa

DBGET integrated database retrieval system