KEGG   Methanocaldococcus jannaschii: MJ_0851Help
Entry
MJ_0851           CDS       T00003                                 

Definition
(GenBank) N5-methyl-tetrahydromethanopterin:coenzyme M methyltransferase, subunit A (mtrA)
  KO
K00577  tetrahydromethanopterin S-methyltransferase subunit A [EC:2.1.1.86]
Organism
mja  Methanocaldococcus jannaschii
Pathway
mja00680  Methane metabolism
mja01100  Metabolic pathways
mja01120  Microbial metabolism in diverse environments
mja01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mja00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MJ_0851
Enzymes [BR:mja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MJ_0851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrA
Motif
Other DBs
NCBI-ProteinID: AAB98856
UniProt: Q58261
Structure
PDB: 

Position
776488..777225
Genome map
AA seq 245 aa AA seqDB search
MVMSMANKREPAPGWPIVSGEYVVGNPESCVGVVTLGSHGLEQACIDAGAAIAGPCHTEN
LGIEKVVANYISNPNIRFMILCGSEVQGHITGQCFKALWENGIGDDGGIIGAKGAIPFLE
NVNKEAVERFRRQIVEVVDLIDCEDIGKITQAIKECLSKDPGAIDEDPFIIELEGGKGGG
EEEEGVIKPITPEMAIIESRMRLIGNEMCYNGLLAKWQAGYYNGKIQGIATGLFLMLLIM
GILMF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgtctatggcaaataaaagagaaccagcaccaggatggccaattgtctctggt
gaatatgttgttggaaatccggaaagttgtgttggagttgtaactttaggttctcacggt
ttggagcaagcatgtatcgatgcaggggctgctatagcaggaccttgccacacagaaaac
ttgggtattgaaaaggttgtagcaaactatatatcaaacccaaacattaggtttatgatt
ctctgtggttcagaagtccaagggcatataactggacagtgttttaaagcattatgggaa
aatggcattggagacgatggaggtattattggagctaaaggggccataccattcttagag
aacgtgaataaagaagcagttgaaagatttagaaggcagatagttgaagttgttgattta
attgactgtgaagatattggtaaaataacacaagcaataaaagagtgtttaagtaaagac
ccaggagctattgacgaagacccatttataattgagttagaaggaggaaaaggaggagga
gaagaggaagagggtgttataaaaccaataacaccagaaatggcaataattgagagtaga
atgagattaattggaaatgaaatgtgctataatggattgttagcaaagtggcaggcagga
tattataatggtaagattcaaggaattgccactggtttgttcttaatgctactaattatg
ggaatcttaatgttctaa

DBGET integrated database retrieval system