KEGG   Methanocaldococcus jannaschii: MJ_1146Help
Entry
MJ_1146           CDS       T00003                                 

Definition
(GenBank) glyceraldehyde 3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mja  Methanocaldococcus jannaschii
Pathway
mja00010  Glycolysis / Gluconeogenesis
mja01100  Metabolic pathways
mja01110  Biosynthesis of secondary metabolites
mja01120  Microbial metabolism in diverse environments
mja01130  Biosynthesis of antibiotics
mja01200  Carbon metabolism
mja01230  Biosynthesis of amino acids
Module
mja_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mja_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MJ_1146
Enzymes [BR:mja01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     MJ_1146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N 2-Hacid_dh_C Sacchrp_dh_NADP TrkA_N DUF5498 DUF4154
Motif
Other DBs
NCBI-ProteinID: AAB99147
UniProt: Q58546
Structure
PDB: 

Position
complement(1085300..1086331)
Genome map
AA seq 343 aa AA seqDB search
MPAKVLINGYGSIGKRVADAVSMQDDMEVIGVTKTKPDFEARLAVEKGYKLFVAIPDNER
VKLFEDAGIPVEGTILDIIEDADIVVDGAPKKIGKQNLENIYKPHKVKAILQGGEKAKDV
EDNFNALWSYNRCYGKDYVRVVSCNTTGLCRILYAINSIADIKKARIVLVRRAADPNDDK
TGPVNAITPNPVTVPSHHGPDVVSVVPEFEGKILTSAVIVPTTLMHMHTLMVEVDGDVSR
DDILEAIKKTPRIITVRAEDGFSSTAKIIEYGRDLGRLRYDINELVVWEESINVLENEIF
LMQAVHQESIVIPENIDCIRAMLQMEEDNFKSIEKTNKAMGIQ
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaaaagtattgataaatggatatggttcaattgggaagagagtagccgatgca
gtttcaatgcaggatgatatggaagttataggagttacaaagacaaagccagattttgag
gcaagattagccgttgagaagggctacaagttgtttgtagcaattccagataatgagagg
gttaaattatttgaagatgcaggaattccagttgaggggactatattggacattatagaa
gatgctgacatagttgttgatggagctcctaagaagattggaaagcaaaacttagaaaat
atctacaaacctcacaaagttaaagctatattgcaagggggagaaaaagcaaaagatgtt
gaagataacttcaacgctttgtggagctacaacagatgctatggaaaagattatgtaaga
gttgtttcatgtaacacaacaggtttgtgtaggatattatatgctataaattcaattgca
gatataaagaaggcaagaatcgtgttagttagaagagcggcagacccaaatgacgacaaa
acagggccagtaaatgctataacaccaaacccagttacagttccttcccatcatggccct
gatgttgtttcagttgtcccagagtttgagggaaagattttaacttcagctgttatcgtt
ccaacaacattaatgcatatgcacactttaatggttgaagttgatggagatgttagcaga
gatgatattttagaagctatcaaaaaaactccaagaattataactgttagagctgaagat
ggatttagttcaacagctaaaataattgaatatggaagagatttaggcaggttaagatat
gacataaacgagcttgttgtctgggaagaaagcattaatgttttagaaaatgaaatattc
ttaatgcaggcggttcatcaagaaagtatagttattcctgaaaatattgattgtattagg
gcaatgcttcagatggaagaagataacttcaaatcaattgaaaagacaaataaagctatg
ggtatccaataa

DBGET integrated database retrieval system