KEGG   Methanocaldococcus jannaschii: MJ_1368Help
Entry
MJ_1368           CDS       T00003                                 

Definition
(GenBank) sulfate transport system permease protein (cysT)
  KO
K15496  molybdate/tungstate transport system permease protein
Organism
mja  Methanocaldococcus jannaschii
Pathway
mja02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mja00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MJ_1368
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mja02000]
    MJ_1368
Transporters [BR:mja02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Molybdate/tungstate transporter
    MJ_1368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF2231
Motif
Other DBs
NCBI-ProteinID: AAB99376
UniProt: Q58763
Position
complement(1317687..1318436)
Genome map
AA seq 249 aa AA seqDB search
MEKFDIAMTVFLVMIFLFIFLPIIYMLSNPGDLNQLLDKEVIEAFKTTLLAGAVATLIAL
IFGIPTGYILARYDFKFKSFVEAVLDLPMAIPHSVIGIIILSFIYGIDIINFIGRYVVDN
FWGIVTVYLFVGIPFMVNSIRDGFLSVDEEIEYVSRTLGASKIRTFFEISLPLIKNNIIS
GIILSFARGISEVGAILIIAYYPKTVPILIYERFMSFGLDASKPISVGMILISIALFALL
RMFGRMRGR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggagaagttcgatattgcgatgacagtgtttttggtaatgatattcttattcatattt
ttaccaattatttatatgctatcaaatcccggagatttaaaccaattgttggataaagag
gttatagaggcgtttaaaactactctattagctggagctgttgctactctaatagctcta
atttttggaataccaactggctatattttggcaaggtatgattttaaatttaaaagcttt
gttgaggctgttttagatttaccgatggcaattcctcacagcgttataggtatcataatc
ctatccttcatttatggtattgatattataaattttattggtagatatgtagttgataac
ttttgggggattgttactgtctatctatttgttggcataccttttatggttaatagtata
agagatggctttttaagtgttgatgaagagattgagtatgtctcaagaaccttgggggct
tcaaagataaggacgttttttgaaatatctctcccattgataaaaaataatatcatctct
gggattattttgagttttgcaagaggaattagtgaggttggagcaatattgataatagca
tattatccaaaaacagttcctatcttaatatatgaaagatttatgagctttggattagat
gcttcaaaaccaatatctgttggaatgattttgattagcatagcgttgtttgcattacta
aggatgtttgggaggatgagagggagataa

DBGET integrated database retrieval system