KEGG   Methanocaldococcus jannaschii: MJ_1465Help
Entry
MJ_1465           CDS       T00003                                 

Definition
(GenBank) threonine synthase (thrC)
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mja  Methanocaldococcus jannaschii
Pathway
mja00260  Glycine, serine and threonine metabolism
mja00750  Vitamin B6 metabolism
mja01100  Metabolic pathways
mja01110  Biosynthesis of secondary metabolites
mja01120  Microbial metabolism in diverse environments
mja01230  Biosynthesis of amino acids
Module
mja_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mja00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MJ_1465
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MJ_1465
Enzymes [BR:mja01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MJ_1465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AAB99473
UniProt: Q58860
Position
complement(1434196..1435413)
Genome map
AA seq 405 aa AA seqDB search
MLQRCIKCGKTYDVDEIIYTCECGGLLEIIYDYEEIKDKVSEEKLRKREIGVWRYLEYLP
VKDESKIVSLCEGGTPLYRCNNLEKELGIKELYVKNEGANPTGSFKDRGMTVGVTRANEL
GVEVVGCASTGNTSASLAAYSARSGKKCIVLLPEGKVALGKLAQAMFYGAKVIQVKGNFD
DALDMVKQLAKEKLIYLLNSINPFRLEGQKTIAFEICDQLNWQVPDRVIVPVGNAGNISA
IWKGFKEFEITGIIDELPKMTGIQADGAKPIVEAFRKRAKDIIPYKNPETIATAIRIGNP
VNAPKALDAIYSSGGYAEAVTDEEIVEAQKLLARKEGIFVEPASASSIAGLKKLLEEGII
DRDERIVCITTGHGLKDPDAAIRASEEPIKIECDMNVLKRILKEL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgttacaaagatgtattaaatgtggaaaaacttacgatgtggatgagataatctacacc
tgcgaatgtggtggcttattggagattatttatgattatgaagagattaaagataaagtt
tcagaagaaaaactaagaaagagagaaattggagtctggagatatttggaatacttacca
gtaaaagacgaaagtaaaattgtaagtctatgtgaaggaggaactccattatatagatgt
aacaacttggaaaaagagcttggaattaaagaactctatgtaaaaaatgaaggggctaat
ccaactggaagctttaaagatagggggatgactgttggagtaacaagggcaaatgagttg
ggtgttgaggttgttggctgtgcttcaacaggaaatacatccgcttctttagccgcttac
tcagcaagaagtggaaagaaatgtattgttctattaccagaaggaaaagttgccttagga
aagttagctcaagcaatgttctatggagctaaggttattcaagtcaaagggaactttgat
gatgcattagatatggttaaacaattagcaaaagagaagttgatttatttattaaattca
ataaatccatttagattagagggacagaaaaccatagcatttgaaatatgtgaccaatta
aactggcaagtcccagatagagttattgttccagttggaaatgctggaaacatctcagct
atatggaaaggatttaaagaatttgaaattactggcattatagatgaactcccaaaaatg
accggaattcaggcagatggagctaagccaattgttgaagcatttagaaagagagctaaa
gacatcatcccatataaaaatccagagacaattgcaacagctataaggattggaaatcca
gtaaatgccccaaaggctttagatgccatatactcctctggaggttatgctgaagcagtt
actgatgaagagattgttgaagctcaaaagctattggcaagaaaagagggaatttttgtt
gaaccagcttcagcttcatcaatagctgggcttaaaaagttattagaagaaggaattatt
gatagagatgaaagaattgtttgtataacaacagggcatgggttgaaagacccagatgca
gctataagggcaagtgaagagccgataaagattgaatgtgatatgaatgttttaaaaaga
attttgaaagagttataa

DBGET integrated database retrieval system