KEGG   Methanocaldococcus jannaschii: MJ_1481Help
Entry
MJ_1481           CDS       T00003                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mja  Methanocaldococcus jannaschii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2100 Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: AAB99493
UniProt: Q58876
Structure
PDB: 

Position
1452730..1453371
Genome map
AA seq 213 aa AA seqDB search
MRVEYSKDLIRKGISTISQLKKAKIRVEKDDKKISYKDAKPGKIDVNEFKKAIYLLIEAD
DFLYKKAPKHELNEEEAKEFCKLIIKCQEHLNKILANFGFEFEEKEIDEGALYIVSNKKL
FKKLKNKNPNLKVVCTEGMLDIEDMRAIGVPEKALEGLKKKVEIARKNVERFIEKYKPEK
IFVVVEDDKDELLYLRAKNLYNAEKLDADEILD
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgagagttgaatattcaaaggatttgataagaaagggaatttcaactatttcccaacta
aaaaaagctaaaataagagtagaaaaggatgataaaaaaatatcctacaaagatgcaaag
ccagggaagatagatgtcaatgaatttaaaaaagctatttatttgttgattgaggcagat
gacttcttatataaaaaagccccaaagcatgagttgaatgaagaggaagctaaagagttc
tgtaaattgattataaaatgccaagaacatttaaataaaatcttagctaactttgggttt
gaatttgaagaaaaagaaatagatgaaggtgcattatacattgtctcaaataaaaagtta
tttaaaaagcttaaaaacaaaaatcctaatttaaaagttgtatgcactgagggaatgtta
gatattgaagatatgagagctataggcgttccagaaaaagcattagaaggattaaagaaa
aaggttgagatagcacgaaagaatgttgagagatttatagaaaaatacaaaccagaaaaa
atttttgttgtggttgaggatgataaagatgaacttctctatttgagggctaaaaatctt
tataatgctgaaaaattggatgctgatgaaattttagattaa

DBGET integrated database retrieval system