KEGG   Mycolicibacter sinensis: JDM601_0897Help
Entry
JDM601_0897       CDS       T01512                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase (beta chain) SucC
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00020  Citrate cycle (TCA cycle)
mjd00640  Propanoate metabolism
mjd00660  C5-Branched dibasic acid metabolism
mjd01100  Metabolic pathways
mjd01110  Biosynthesis of secondary metabolites
mjd01120  Microbial metabolism in diverse environments
mjd01130  Biosynthesis of antibiotics
mjd01200  Carbon metabolism
Module
mjd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mjd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    JDM601_0897 (sucC)
   00640 Propanoate metabolism
    JDM601_0897 (sucC)
   00660 C5-Branched dibasic acid metabolism
    JDM601_0897 (sucC)
Enzymes [BR:mjd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     JDM601_0897 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AEF34897
UniProt: F5YT69
Position
966899..968074
Genome map
AA seq 391 aa AA seqDB search
MDLFEYQAKELFAKHNVPTTPGRVTTSAEDAKAIATEIGRPVMVKAQVKVGGRGKAGGVK
YAATPEDAFTHAQNILGLDIKGHVVKKLLVAEASDIAEEYYISFLLDRSNRTYLAMCSVE
GGMEIEEVAATKPERLAKVPVDAVKGVDLAFARSIAEQGHLPAEVLDAAAVTIQKLWEVF
VAEDATLVEVNPLVRTPDDQILALDGKVTLDGNAEFRQPGHAEFADIEATDPLELKAKEN
DLNYVKLDGQVGIIGNGAGLVMSTLDVTAYAGEKHGGVKPANFLDIGGGASAEVMAAGLD
VILGDKQVKSVFVNVFGGITACDAVANGIVSALKILGDAATKPLVVRLDGNNVEEGRQIL
ADANHPLVTLVDTMDEAADKAAELAYAGKDA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggatctattcgagtatcaggcgaaggaactgttcgctaagcacaacgtaccgaccacc
ccgggccgggtaaccacctcggccgaggacgccaaggccatcgccaccgagatcggtcgg
cccgtcatggtgaaggcccaggtcaaggtcggcggccgcggcaaggccggtggtgtcaag
tacgccgccaccccggaagacgcattcacccacgcgcagaacatcctcggtctggacatc
aagggccacgtcgtcaagaagctgctggtggccgaggccagcgacatcgccgaggagtac
tacatctcgttcctgctcgaccgctccaaccgcacctacctggccatgtgctcggtcgag
ggcggcatggagatcgaagaggtcgccgcgaccaagcccgagcggctggccaaggtcccc
gtcgacgcggtcaagggcgtcgacctggcgttcgcccgctcgattgccgagcagggccac
ctgcccgccgaggtgctcgacgccgccgcggtgacgatccagaagctgtgggaggttttc
gtcgctgaagacgccacgctcgtcgaggtcaatccgctggtgcgcacccccgatgaccag
atcctggcgctcgacggcaaggtcaccctcgacggcaacgccgagttccgccagcccggc
cacgccgagttcgccgacatcgaggcgaccgacccgctggagctcaaggccaaggagaac
gacctcaactacgtcaagctcgacggccaggtcggcatcatcggcaacggcgccggcctg
gtcatgtccacgctggacgtcaccgcctacgccggtgagaagcacggcggcgtcaagccg
gccaacttcctcgacatcggcggcggcgcctccgcggaggtgatggccgccggcctggat
gtgattctgggcgacaagcaggtcaagagcgtgttcgtcaacgtgttcggtggcatcacc
gcctgcgacgcggtggccaacggcatcgtgtcggcgctgaagatcctcggcgacgcggcc
accaagccgctggtggtccggctcgacggcaacaacgtcgaggagggccggcagatcctg
gccgacgccaaccacccgctggtgacgctcgtcgacaccatggacgaggccgccgacaag
gccgctgagctcgcgtacgccggaaaggacgcataa

DBGET integrated database retrieval system