KEGG   Mycolicibacter sinensis: JDM601_1020Help
Entry
JDM601_1020       CDS       T01512                                 

Gene name
fadA3
Definition
(GenBank) beta-ketoacyl CoA thiolase FadA3
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00071  Fatty acid degradation
mjd00072  Synthesis and degradation of ketone bodies
mjd00280  Valine, leucine and isoleucine degradation
mjd00310  Lysine degradation
mjd00362  Benzoate degradation
mjd00380  Tryptophan metabolism
mjd00620  Pyruvate metabolism
mjd00630  Glyoxylate and dicarboxylate metabolism
mjd00640  Propanoate metabolism
mjd00650  Butanoate metabolism
mjd00900  Terpenoid backbone biosynthesis
mjd01100  Metabolic pathways
mjd01110  Biosynthesis of secondary metabolites
mjd01120  Microbial metabolism in diverse environments
mjd01130  Biosynthesis of antibiotics
mjd01200  Carbon metabolism
mjd01212  Fatty acid metabolism
mjd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mjd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    JDM601_1020 (fadA3)
   00630 Glyoxylate and dicarboxylate metabolism
    JDM601_1020 (fadA3)
   00640 Propanoate metabolism
    JDM601_1020 (fadA3)
   00650 Butanoate metabolism
    JDM601_1020 (fadA3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    JDM601_1020 (fadA3)
   00072 Synthesis and degradation of ketone bodies
    JDM601_1020 (fadA3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    JDM601_1020 (fadA3)
   00310 Lysine degradation
    JDM601_1020 (fadA3)
   00380 Tryptophan metabolism
    JDM601_1020 (fadA3)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    JDM601_1020 (fadA3)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    JDM601_1020 (fadA3)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JDM601_1020 (fadA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mjd04147]
    JDM601_1020 (fadA3)
Enzymes [BR:mjd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     JDM601_1020 (fadA3)
Exosome [BR:mjd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   JDM601_1020 (fadA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt BsuBI_PstI_RE Dodecin
Motif
Other DBs
NCBI-ProteinID: AEF35020
UniProt: F5YTZ7
Position
complement(1092876..1094093)
Genome map
AA seq 405 aa AA seqDB search
MPEAVIVSTARSPIGRAGKGSLVTMRPDDLAAQMVRAALDKVPELNPHQIDDLMMGCGQP
GGAAGYNIARVVSVLLGYDFLPGTTVNRYCSSSLQTTRMAFHAIKAGEGDAFISAGVETV
SQFGIGAADGAPDSKNPLFNDAMARNEAAAAGAEEWHDPRADGNLPDIYIAMGQTAENVV
LHTGISREDQDHWGVRSQNRAEEAIKSGFFAREISPVTLPDGSTVSVDDGPRAGTTYEKI
SQLKPVFRPNGTVTAGNACPLNDGAAAVVITSDTKAKQLGLKPLARIVATGVSGLSPEIM
GLGPIEAVKKALTNAKMSVSDIDLFEINEAFAVQVLGSARELGIDEDKLNVSGGAIALGH
PFGMTGARITATLLNNLATHDKTFGVETMCVGGGQGMAMVVERLS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgaagccgtcatcgtctcaactgctcgctcaccgatcggccgggccggtaagggt
tcgctggtcaccatgcggcccgacgacctggccgcgcagatggtgcgcgccgccctggac
aaggtgcccgagctcaacccgcaccagatcgacgacctgatgatgggctgcggccagccc
ggcggcgccgccggctacaacatcgcccgcgtggtgtcggtgctgctcggctacgacttc
ctgccgggcaccacggtcaaccgctactgctcgtcgtcactgcagaccacccggatggcg
ttccacgcgatcaaggccggcgagggcgacgcgttcatctccgccggggtggagaccgtc
tcgcagttcggcatcggtgccgctgacggcgcaccggacagcaagaacccgctgttcaac
gacgccatggcccgaaacgaggcggctgctgccggtgccgaggagtggcatgacccgcgc
gccgacggcaacctgcccgacatctacatcgcgatgggccagaccgccgagaacgtggtg
ctgcacaccgggatcagccgcgaggaccaggaccactggggggtgcgcagccagaaccgc
gccgaggaagccatcaagagcggcttcttcgcccgggagatctccccggtgacgctgccg
gacggcagcaccgtcagtgtcgatgatggcccgcgcgccggcaccacctacgagaagatc
agccagctcaagccggtgttccgtcccaacggcacggtgaccgccggtaacgcctgccca
ctcaacgacggcgcggccgccgtggtcatcaccagcgacaccaaggccaagcagctcggc
ctcaagccgttggcccggatcgtggccaccggtgtgtcgggcctgtcgccggagatcatg
ggcctgggcccgatcgaggcggtcaagaaggcgctgacgaacgcgaagatgtcggtctcg
gacatcgacctgttcgagatcaacgaggccttcgcggtgcaggtgctcggctcggcgagg
gagctgggtatcgacgaggacaagctcaacgtgtccggtggggcgatcgccctgggccac
ccgttcggcatgaccggcgcccgcatcaccgccaccctgctgaacaacctggccacccac
gacaagaccttcggcgtggagacgatgtgtgtcggcggcggccagggtatggcgatggtc
gtggagcggctgagctga

DBGET integrated database retrieval system