KEGG   Mycolicibacter sinensis: JDM601_1420Help
Entry
JDM601_1420       CDS       T01512                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoamide S-acetyltransferase E2 component PdhC
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00010  Glycolysis / Gluconeogenesis
mjd00020  Citrate cycle (TCA cycle)
mjd00620  Pyruvate metabolism
mjd01100  Metabolic pathways
mjd01110  Biosynthesis of secondary metabolites
mjd01120  Microbial metabolism in diverse environments
mjd01130  Biosynthesis of antibiotics
mjd01200  Carbon metabolism
Module
mjd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JDM601_1420 (pdhC)
   00020 Citrate cycle (TCA cycle)
    JDM601_1420 (pdhC)
   00620 Pyruvate metabolism
    JDM601_1420 (pdhC)
Enzymes [BR:mjd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     JDM601_1420 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AEF35420
UniProt: F5YY41
Position
1523831..1525033
Genome map
AA seq 400 aa AA seqDB search
MSTAQIQTFAVPDLGEGLEELTVTRWEVAVGDEVELNQTLCSVETAKAEVEIPSPYAGRI
VELGGAEGDVLAVGAPLVRIDTGTAAESSTQPVEAAPPVRTPVLVGYGADDTVDTSRRAC
ASSPRPKAKPGARKLAAELGVDLGGVPPGPRGVITTDGVLAAATGDRPADELRPVSPVQA
AMAQRMAMARSRIPDAHAAVQVDCANLLQLRDRLADDADGTSITPFTLTLRLLILALTRH
PVLNATWVDSPGGPQVRAHRAIHLGVGVATPRGLLVPVVFDAHRKTTRELADCVTRLIAG
ARAGSLQPAELQGSTFTVSNFGALGIDDGVPVINYPEAAILGMGSLKPRPVAIDDAVVVR
PQMTLTCAFDHRIADGAQVAEFLCALRDLIEHPDTALLDL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacagcacaaatccagacgttcgcggttcccgacctgggtgagggactcgaagag
ctcacggtgacccgctgggaggtggccgtcggcgacgaggtggaactcaaccagacgctg
tgctcggtggagacggccaaagccgaagtggagattcccagcccgtacgccggccggatc
gtcgaactcggcggtgccgagggtgacgtgctcgcggtcggggcgccgctggtgcgaatc
gacaccggtacggcggctgagtcttcgacccagcccgttgaagcggctccgccggtgcgc
acgccggtgctggtcggctacggcgccgacgacaccgtcgacaccagccgccgagcctgc
gcgagctccccccggcccaaagccaagccgggcgcccgcaagctcgccgccgagctgggc
gtggacctgggcggcgtgccaccgggaccgcgcggcgtgatcaccaccgacggcgtgctg
gccgcggcgaccggcgatcggccggccgacgagttgcgcccggtgagtccggtgcaggct
gcgatggcacaacgaatggccatggcccgcagcaggatcccggatgcccatgccgccgta
caggtggactgcgccaacttgctgcagctgcgcgaccgtctcgccgacgacgccgacggc
acatcgatcacgccgttcacactgacgctgcgactgctgatcctcgccctgacccgtcat
ccggtgctcaatgcgacctgggtcgactcgccgggaggcccccaggtgcgcgcccaccgc
gccatccacctcggagtcggggtggccaccccgcgtggcctgctggtcccggtggtgttc
gacgcgcaccgcaagaccacccgggaactcgccgactgcgtgacgcggctcatcgccggc
gctcgtgccggtagccttcaaccggccgaactgcagggatcgacgttcaccgtctccaac
ttcggcgccctcggaatcgacgacggggtgccggtgatcaactaccccgaggcggcgatc
ctgggcatgggttcgctgaaaccgcggccggtggccatcgacgacgccgtcgtggtccgc
ccgcagatgacgttgacctgtgcgttcgaccaccgaatcgccgacggtgcgcaggtcgcc
gaattcctgtgtgcgctacgcgatctgatcgaacatcccgataccgcgctgctggacctg
tag

DBGET integrated database retrieval system