KEGG   Mycolicibacter sinensis: JDM601_2363Help
Entry
JDM601_2363       CDS       T01512                                 

Definition
(GenBank) L-fuculose-phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00051  Fructose and mannose metabolism
mjd01100  Metabolic pathways
mjd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mjd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    JDM601_2363
Enzymes [BR:mjd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     JDM601_2363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AEF36363
UniProt: F5YVE2
Position
complement(2567795..2568577)
Genome map
AA seq 260 aa AA seqDB search
MASTFDDSKSDLMEQAERRFAANVGQDSWSIRQKLALTCRALFDRGHDSGLAGQITARAE
APGTYYTQRLGLGFDEITQDNLLLVDEDLNVLQGEGMANPANRFHSWIYRVRPDVQCIVH
THPFHVAALSMLETPLVISHMDTTPLYDDCAFLPTWPGVPVGNEEGEIISQALGDKKAIL
LAHHGQIVAGASVEEACSLAVLIERAAALQLAAMAAGTIKELPERLAREAHDWTLLPNRS
VANFAYYARRALAGHPDAIT
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccagcacgttcgacgactccaagtccgatctgatggagcaggcggaacggcgcttc
gcggcgaatgtcgggcaggacagctggtccatccgccagaaactggcgctgacctgccgg
gcgctgttcgaccgcggtcacgactcggggctggccgggcagatcaccgcccgcgcggag
gcgcccggcacctactacacccagcggctcggcttgggcttcgacgagatcacgcaagac
aacctgttgctcgtcgacgaagacctcaacgtcctgcaaggcgagggaatggccaacccc
gccaaccgattccacagctggatctaccgggtgcgccccgacgtgcagtgcatcgtgcac
acccacccattccatgtggccgccctgtcgatgctggagaccccactggtcatctcgcac
atggacaccactccgctctacgacgactgcgcgttcctgccgacctggcccggggttccg
gtcggcaatgaggaaggcgagatcatctcgcaggccctgggcgacaaaaaggcgatcctg
ttggcgcaccacggtcagatcgtggccggtgccagcgtcgaggaggcgtgctcgctggcg
gtgctgatcgaacgcgccgccgcgctgcaactggccgccatggccgccggcaccatcaag
gaactccccgaaaggctggcccgcgaagcccacgactggaccctgctgcccaaccgcagc
gtcgccaatttcgcctactacgcccgacgggcgctggccggccaccccgacgcgatcacc
tga

DBGET integrated database retrieval system