KEGG   Mycolicibacter sinensis: JDM601_2509Help
Entry
JDM601_2509       CDS       T01512                                 

Gene name
dfrA
Definition
(GenBank) dihydrofolate reductase DfrA
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00670  One carbon pool by folate
mjd00790  Folate biosynthesis
mjd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    JDM601_2509 (dfrA)
   00670 One carbon pool by folate
    JDM601_2509 (dfrA)
Enzymes [BR:mjd01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     JDM601_2509 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AEF36509
UniProt: F5YWQ4
Position
complement(2698677..2699159)
Genome map
AA seq 160 aa AA seqDB search
MTALGLIWAQSTSGVIGRDGGIPWRLPEDQARFKELTLGHRVVMGRLTWESLPAGVRPLP
GRANVVVSRRSDYRAVGAEVVPTLDAALTDAETWVIGGAQIYALALPLADRCEVTEVEID
LPRQDEDAVAPVLDESWRGTAGPWLTSARGLRYRFCSYHR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgctcgggctgatctgggcccagtcgacgtccggggtgatcgggcgtgacggc
ggcatcccgtggcggctgcccgaagaccaggcgcgtttcaaggaactcaccctgggacac
cgggtggtgatgggccggttgacctgggaatcgctgccggccggcgtgcgtccgctgccc
ggccgggccaacgtggtggtcagccgccggagcgactaccgcgccgtcggggccgaggtg
gttccgaccctcgacgcggcgctgaccgatgccgagacctgggtgatcggcggggcgcag
atctacgcgctggcgctgccgctggccgaccggtgcgaggtgaccgaggtggagatcgac
ctgccccggcaagacgaggacgccgtcgcaccggtgctcgacgaaagctggcggggcacc
gcggggccgtggctcaccagcgcgcgcggcctgcggtaccggttctgcagctaccaccgc
tga

DBGET integrated database retrieval system