KEGG   Mycolicibacter sinensis: JDM601_3027Help
Entry
JDM601_3027       CDS       T01512                                 

Gene name
ackA
Definition
(GenBank) acetate kinase AckA
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00430  Taurine and hypotaurine metabolism
mjd00620  Pyruvate metabolism
mjd00640  Propanoate metabolism
mjd00680  Methane metabolism
mjd01100  Metabolic pathways
mjd01120  Microbial metabolism in diverse environments
mjd01200  Carbon metabolism
Module
mjd_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:mjd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    JDM601_3027 (ackA)
   00640 Propanoate metabolism
    JDM601_3027 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    JDM601_3027 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    JDM601_3027 (ackA)
Enzymes [BR:mjd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     JDM601_3027 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AEF37027
UniProt: F5Z227
Position
complement(3235354..3236499)
Genome map
AA seq 381 aa AA seqDB search
MSAVSAGVVLVLNSGSSSIKFRLIDPVAGTAVVSGLVEQIGEPDSAVADHAAGLRLIHQR
LADSGVDLGEVRAVGHRVVHGGTRFHAPTLITDAVVAEVSRLAELAPLHNPANVIGIEVA
RADFPDVPHVAVFDTGFFHSLPAAAAAYAIDREVASQYGIRRYGFHGTSHEYVSREAALL
LGREPAEVNTIVLHLGNGASASAVRGGVAVETSMGLTPLEGLVMGTRCGDIDPGVLFHLN
RTAGLGVDKLDELLNRRSGLKGLSGVNDFRELLQQVSHGSSAATLAYDVYIHRLRKYVGA
YLAVLGRVDAIAFTAGVGENVAAVREDALAGLDGLGIVVDPQRNRGGNGARIISAEHSRS
TVLVVPTNEELAIARAAWQFV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcggtgtcggccggggtggtgctggtgctcaactccggctcgtcgtcgatcaag
ttccggctgatcgacccggtggccggaaccgcggtggtgtcggggctggtggagcagatc
ggcgaaccggactcggcggtcgccgaccacgccgccggactgcggctgatccatcaacgg
ttggccgattccggcgtggacctcggtgaggttcgagcggtaggccaccgggtggtccac
ggcggcaccaggtttcacgcaccgaccctgatcaccgacgcggtggtggccgaggtatcg
cggctcgccgaactggcgccgctgcacaatccggccaatgtgatcggcatcgaggtcgcc
agagccgacttcccggatgtgccgcacgtggcggtgttcgacaccggcttcttccactcc
ctgccggcggccgccgccgcctatgcgatagaccgtgaggtggcaagccagtacggcatc
cgccggtacgggttccacggcacctcgcacgagtacgtctcccgcgaggccgcgctgttg
ctgggccgcgagcccgcggaggtgaacactatcgtgttgcacctgggcaacggcgcgtcg
gcgtcggcggtccgcggcggggtggccgtcgagacctcgatgggtctgacgccgctcgag
gggctggtgatgggaacccgctgcggcgacatcgatcccggcgtgctgtttcatctcaac
cgcaccgccggcctgggcgtcgacaagctcgatgagttgctcaaccggcgctccgggctc
aaggggctatccggggtcaatgatttccgcgaactgctacaacaggtttcacacgggtcg
tcggccgcgacactggcctatgacgtctacatccaccggctgcgcaagtacgtcggcgcc
tacctggcggtgctgggccgcgtcgacgcgatcgccttcaccgcgggagtgggggagaac
gttgccgcggtgcgcgaggacgcgctggccggcctggacggcctgggtatcgtcgtcgac
ccgcagcgcaatcgcggcggcaacggcgcgcggatcatctctgccgagcactcgcgcagc
accgtgctggtggtgcccaccaacgaggagctggcgatcgcccgggcggcttggcagttc
gtgtga

DBGET integrated database retrieval system