KEGG   Mycolicibacter sinensis: JDM601_3028Help
Entry
JDM601_3028       CDS       T01512                                 

Gene name
pta
Definition
(GenBank) phosphate acetyltransferase Pta
  KO
K13788  phosphate acetyltransferase [EC:2.3.1.8]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00430  Taurine and hypotaurine metabolism
mjd00620  Pyruvate metabolism
mjd00640  Propanoate metabolism
mjd00680  Methane metabolism
mjd01100  Metabolic pathways
mjd01120  Microbial metabolism in diverse environments
mjd01200  Carbon metabolism
Module
mjd_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:mjd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    JDM601_3028 (pta)
   00640 Propanoate metabolism
    JDM601_3028 (pta)
  09102 Energy metabolism
   00680 Methane metabolism
    JDM601_3028 (pta)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    JDM601_3028 (pta)
Enzymes [BR:mjd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     JDM601_3028 (pta)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB DRTGG AAA_26 CbiA
Motif
Other DBs
NCBI-ProteinID: AEF37028
UniProt: F5Z228
Position
complement(3236496..3238598)
Genome map
AA seq 700 aa AA seqDB search
MTEADPARASSIYLAAAEGGTGKAVIALGLLHLLAASSARVGVFRPIVRSLDGPDEQLEL
LLAHATARIDDHGSCRGVTYQQVYADREAALGEIVTRFHEVARQCDTVLVVGSDYSDVVN
PSELTFNARVAVNLGAPLVLAINGHHREAQDIAEITARCLAEAAAVHAQPAAVIANRCDP
DRLTEITEAISGQPAAADLPAFAVPEVALLSAPTMAELCAALDGTVYSGDPELLRREALS
VMVGGMTAENILERLTEGQVVIVPADRSDVLLALVNAHDAQGFPSLAGIILNGGLLPHPA
IDKLVKGLRPTLPLIATGHRTYDTAEQVSHTGSRITVDSLRKIDTALQVMADHVDGVELA
ERIRVPASTVVTPQMFTYRLLERARADRRHIVLPEATDDRILLAAGRLLSRGIVDLTLLG
VEDVVRRRGAELGVDLETAQVVDPASSGLLDSFGAEYARLRAHKGMTEDRAREIMRDISY
FGTMMVQLGIADGMVSGAAHTTAHTIRPAFEIIRTAPGVSTVSSVFLMCLSDRVLAYGDC
AVVPDPTVEQLADIAISSAATAAAFGIEPRVALLSYSTGESGAGAGVDKVRAATQLVHER
RPDLLADGPIQYDAAVDAGVAAAKLPDSAVAGRATVLVFPDLNTGNNTYKAVQRSAGAVA
IGPVLQGLAKPVNDLSRGALVDDIVYTVAITAIQAQEVAR
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagccgatccggcccgcgcatcgagcatctacctggccgccgccgagggcggc
accggcaaggccgtcatcgcgctggggctgctgcacctgttggccgcctcgtcggcgcgg
gtcggggtgttccgcccgatcgtccgctcgctggacgggcccgatgagcaactcgagctg
ctactggcgcacgccaccgccaggatcgacgaccacggcagctgtcgcggcgtgacctac
cagcaggtctacgccgaccgggaagccgcgctgggcgagatcgtcacccggtttcacgag
gtcgcgcgccaatgcgacaccgtgttggtggtcggcagtgactacagcgacgtggtcaac
ccgagcgagttgacgttcaacgcccgcgtcgcggtgaacctcggcgcgccgctggtgctg
gccatcaacggtcaccaccgcgaggcgcaagacatcgctgagatcaccgcgcgctgcctg
gccgaggcggcggccgtacatgcgcagccggcggcggtgatcgccaaccgctgcgacccc
gaccggttgacggagatcaccgaggcgatctcgggtcagccggccgccgccgacctcccg
gcgttcgccgttccggaggtggcgctgctgtccgcgccgacgatggccgagctctgcgcg
gcgctcgacggcaccgtctacagcggtgacccggagctgctgcgccgggaggcgctgagc
gtcatggtcggcggcatgaccgccgagaacatcctggagcggctcaccgagggccaggtg
gtgatcgtgccggccgatcgttccgacgtgctgctggcattggtgaacgcccatgacgcg
cagggttttccgtcgctggccgggatcattctcaacggcggtctgctgccgcacccggcc
atcgacaagctggtcaaggggctgcgccccacgctgccgctgatcgccaccggccaccgc
acctatgacaccgccgagcaggtgtcgcacaccgggtcccggatcaccgtcgattcgctg
cgcaagatcgacaccgcgctgcaggtgatggccgaccacgtcgatggcgtcgaactggcc
gaacggatccgggtgccggcgtcgacggtggtgaccccgcagatgttcacctaccggctg
ctggaacgggcccgggccgaccgccgccacatcgtgctgccggaggccaccgatgaccgg
atcctgctggccgccggccggttgctgtcccgcggcatcgtggacctgacgctgctcggg
gtggaggatgtggtgcgccgacgcggcgccgagctcggcgtcgacctggagacggcgcag
gtggtcgacccggccagcagcgggctgctggattcgttcggtgcggaatacgcccggctg
cgcgcccacaagggcatgaccgaggaccgcgcccgcgagatcatgcgcgacatctcctat
ttcggcaccatgatggtgcaactcggtatcgccgacggcatggtgtccggtgccgcgcac
accaccgcccacaccatccggccggcgttcgagatcatccggaccgcgccgggagtgtcg
acggtgtccagtgtgttcctgatgtgcctgtcggaccgggtgctggcctacggcgactgt
gcggtggtgcccgacccgaccgtcgagcaactcgccgacatcgccatctcgtcggcggcc
accgccgcggcattcggtatcgaaccccgggtggcgctgctgtcgtattccaccggtgaa
tccggcgccggtgcaggtgtcgacaaggtacgtgccgcaacgcaactggtacacgagcgg
cgccccgatctgctcgccgacggaccgatccagtacgacgccgcggtcgatgcgggggtg
gcggcggccaaactgccggattcggcggtggccggacgggccaccgtgctggtcttcccc
gatctcaacaccggcaacaacacctacaaggcggtgcagcgcagcgccggcgcggtggcg
atcgggccggtgctgcaaggcctggcgaaaccggtcaacgacctgtcgcgtggtgcgctg
gtcgacgacatcgtctacacggtggcgatcaccgcgatccaggcgcaggaggtggcccgg
tga

DBGET integrated database retrieval system