KEGG   Mycolicibacter sinensis: JDM601_3167Help
Entry
JDM601_3167       CDS       T01512                                 

Definition
(GenBank) magnesium chelatase
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00860  Porphyrin and chlorophyll metabolism
mjd01100  Metabolic pathways
mjd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    JDM601_3167
Enzymes [BR:mjd01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     JDM601_3167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 AAA_5 VWA Mg_chelatase MCM VWA_3 VWA_CoxE Sigma54_activat AAA_16 AAA AAA_29
Motif
Other DBs
NCBI-ProteinID: AEF37167
UniProt: F5Z3T9
Position
3364882..3366858
Genome map
AA seq 658 aa AA seqDB search
MQQLYPFPAVLGGDPDAPGGLDDMALALVLSAISPGIGGVLIRGEKGTAKSTLVRALAQV
LPAIDVVAGDRFSSDPAEPNPLSPDGPFPADAAVQTRPVRLVELPVGATEDRVVGSIHLE
RALGSGAVEFEPGLLARANRGILYVDEVNLLADHLVDLLLDAAAMGRLTVERDGVSVSHA
ARFVIVGTMNPEEGELRPQLLDRFGLTVEVSAPRDPALRAEAVRRRLAFDADPEAFARDY
ADAEERLRARIRNAQELLPRVELTDAALVRIGEICAAFDVDGLRGDIVCARTAVAHAAWQ
GRDAVNIEDLRVAARLALPHRRRRKPFDAPGLDETELDELLPPQDSGPEPDPDPDGPEPD
GPPDGGNAAQPEQRGPAPAKTGATSTVGADSPYRARLFTVDGVGSGRAGRRSRARTSSGR
RVGATAVGAAGGLHLFETLRAAAPHQGARGRVDGPMLLQAADLRRAVREGREANLVLFVV
DTSGSMAAAERMRHVKTAILSLLLDAYRRRDRVAVVTFRDTGAQVALPATGSVEIAAVRL
DELPAGGRTPLAEGLLEAGEVIRRERLRDPASRPLLVVLTDGRATAGADPVERSRQAALQ
LAEHGFSAVVVDCESGRMRLGLARTLAEQLRADYVPLPQVSAEALSGIVRDVTGKGAA
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgcaacagctgtacccgtttcctgccgtgctcggcggcgacccggacgctccgggcggc
ctcgacgacatggccttggcgctcgtgctgagcgcgatctcccccggcatcggcggggtt
ctcatccgcggcgagaagggcacggccaagtcgacgctggtacgggcgctggcccaggtg
ctccccgccatcgacgtggtggccggcgaccggttctcctccgatcccgcagagccgaac
ccgctctccccggacggcccgttccccgccgacgccgccgtgcagacccgcccggtgcgg
ctggtggagcttccggtcggcgccaccgaggaccgggtggtcggctccatccatctggaa
cgagcgctggggtccggcgccgtggagttcgagcccggcctgctggcgcgtgccaaccgc
ggcatcctctacgtcgacgaggtcaacctcctcgccgaccacctggtggacctgttgctg
gacgccgccgccatgggccggctgaccgtggaacgcgacggggtctcggtcagccacgcc
gcacgtttcgtgatcgtcgggacgatgaaccccgaggagggcgagctgcgcccgcagttg
ctcgaccgattcgggctgacggtcgaggtgtccgcgccgcgcgatccggcgctgcgcgcc
gaggcggtccgccggcggttggcgttcgacgccgatcccgaggccttcgcccgcgactac
gccgacgccgaggagcggctgcgagcccggatccgcaatgctcaggagctgctgccgcgg
gtggagctcaccgacgccgcgctggtgcggatcggcgagatctgtgcggctttcgacgtc
gacggcctgcgcggcgacatcgtgtgtgcccgtaccgcggtcgcgcacgccgcctggcag
gggcgcgacgcggtcaacatcgaggatctgcgggtggccgcccggctggccctgccgcat
cggcgccggcgcaagccatttgacgccccggggctcgatgaaaccgagctcgacgagctg
ctgccgccgcaggattccggcccggagccagacccggatcccgacggccccgagcccgac
ggtccgccggacggcggcaacgccgcgcaacccgagcagcgcgggcccgcgccggcaaaa
accggcgccacctcgaccgtcggcgctgactccccttaccgggcacggcttttcaccgtc
gacggggtcggctccggccgtgccggccggcgcagccgggcccgcaccagttccgggcgc
cgcgtgggtgccaccgccgtcggcgccgccgggggcctgcacctgttcgagacgctgcgg
gccgccgccccgcatcagggcgcccgaggccgggtcgacggcccgatgctgctgcaggcc
gccgatcttcgccgcgccgtccgggagggccgggaggccaacctggtgctgttcgtcgtg
gacacctccggctcgatggccgccgccgagcggatgcggcacgtcaagaccgcgatcctg
tcgctgttgctcgacgcctaccgccgccgggaccgggtggcggtggtgacgttccgcgac
accggagcgcaagtggcactgcccgcgaccgggtcggttgagatcgccgcggtgcgcctc
gacgagctgcccgccggtggccgcacgccgctggccgagggactgctcgaggccggtgag
gtgatccgccgggaacggctgcgcgacccggcgtcacgcccgctgctggtggtgctgacc
gacggccgggccaccgccggcgccgacccggtcgagcggtcgcggcaggccgcgctgcag
cttgccgaacatgggttttccgccgtcgtcgtcgattgtgagagcggccggatgcggctc
gggttggcgcgcaccctggccgagcagctgcgggccgactacgtgccgctgccgcaggtc
agtgccgaggcgctcagcggcattgttcgtgacgtcactggaaagggggccgcctga

DBGET integrated database retrieval system