KEGG   Mycolicibacter sinensis: JDM601_3640Help
Entry
JDM601_3640       CDS       T01512                                 

Definition
(GenBank) asparagine synthetase-like protein
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00250  Alanine, aspartate and glutamate metabolism
mjd01100  Metabolic pathways
mjd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    JDM601_3640
Enzymes [BR:mjd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     JDM601_3640
Peptidases [BR:mjd01002]
 Cysteine Peptidases
  Family C44
   JDM601_3640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6
Motif
Other DBs
NCBI-ProteinID: AEF37640
UniProt: F5Z273
Position
3845181..3846974
Genome map
AA seq 597 aa AA seqDB search
MPPARPSLDGFLVTLPTETPVRVLGWPRFHRVGESAVWFHGFLASQASLRRELDLPKSAP
VAQIVVAGLRRWPTDAAERMVGEYAVVVVNGPDAVLFGDRMGLRPLYFAGGADGTVVSTD
LGALVRQTGAWHEPDEDYLADMFSTGLHLGPRTPYRGISRLQPGEFASCRAGRLRVRGGW
RPLAEPRHGTFDEHQELLRATVKHAVAGALSSDGTDAVELSGGLDTSTVLAVATGITPIP
ALSFVHPGSPGSDESSWIRAALRSTPAPWHPIDATEHGPFTAGPELGIFLPAPTRRILNW
APSAAEEAVARGLGATTILTGEGGDAVFFAGLLPWYLADLLRTGRWARLQRESLRWGAQS
ELGRSAAFWVRRAAIDGLRRWRSGRTLTLEPPRPIAASAPWLRQAYIERHRLQHRAQVTT
TVRAQSVHGQAVVENVLRCVEFARSRQLFAPEGIELRHPLLAPSLVDVAMTTPWDIAADP
RIDRAVQRYAFAGLVSETVLRRRSKSIADEAILHGFERNPRWREYLGSNPQIVQRGYVDA
EAWDSALRSAGRIGAVTQFYTAMQIEVWLRHLHYAADPTQRIAASEYFGPDSTEFET
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgccaccggcccggccatcactggatggattcctggtaacgctgcccaccgagacaccg
gtacgcgtcctcgggtggccccggtttcaccgcgtcggcgaatccgcggtgtggttccat
ggcttcctcgcgagccaggcatcgcttcgcagggagttggacctgccgaaatcggcaccc
gtggcgcagatcgtggtggccgggttgcggcggtggcccaccgacgcggccgaacgcatg
gtcggcgagtacgccgtagtggtggtgaacggccccgatgccgtcctgttcggggaccgc
atgggcctgcgtccgctgtacttcgccggcggggcggatggcaccgtggtctcgaccgac
ctcggcgccctggttcgccagaccggcgcctggcatgaacccgacgaggactacctggcc
gatatgttcagcaccggcttgcatctggggccccgaacgccgtatcgcggcataagccgg
ctacaacccggtgagttcgccagctgccgggcgggccgcttgcgggtacgaggtggttgg
cggcccctcgcggaaccgcgtcacggaaccttcgacgaacaccaggaactactgcgcgcg
accgtcaaacatgctgtcgcgggcgcattgtcgtctgacggtacggacgccgtcgagttg
tcgggcgggctggacacctcgaccgtcttggcggttgccaccggcatcactccgatacct
gcgctgagcttcgtccatcccggctccccgggcagcgacgagtcgtcttggattcgggca
gcccttcgatcgacgccggccccgtggcatccgatcgatgccaccgagcatgggcccttc
acggcggggccggaactgggcatctttctgccggcaccgacacgacggattctcaactgg
gcgcccagcgctgccgaggaggctgttgcgagggggctgggggcgacgacgattctgacc
ggcgaaggcggggacgccgtgttcttcgcgggcctgctcccctggtacctggccgacctg
ttgcgcaccggaagatgggcgcgactacagcgcgagtcgctgagatggggcgcccagtcc
gaactggggcgttccgccgcgttctgggtacggcgtgcggcgatcgacggactgcggcga
tggcgaagcggccggacgctcacgctggaaccaccccggcccatcgccgcatcggcaccg
tggttacgccaggcctacatcgagcgtcaccgcctgcagcaccgcgcacaggtcaccacg
accgtccgtgcgcagtcggtgcacggccaggccgtcgtggagaacgtcctgcgctgtgtc
gagttcgccagatcccgccagctgttcgcccccgagggcatcgaactgcgtcatccactg
ctggcgccttcactggtcgacgtggctatgaccacgccgtgggacatcgccgcagatcct
cggatcgaccgtgccgtgcaacggtacgcgttcgccgggctggtcagcgagaccgtactt
cgccggcgatcgaagtcgatcgccgacgaggcgatattgcacggctttgagcgcaacccc
cgctggcgcgaatacctcggctcgaatccgcagatcgtgcagcgcggctatgtcgacgcc
gaggcctgggacagcgcgctgcgctccgccggccgcatcggcgcggtgacccagttctac
accgcgatgcagatcgaggtctggctgcgccacctgcactatgcggccgacccgacacaa
cggattgccgcgtcagagtactttggtcccgattccacggagttcgagacatga

DBGET integrated database retrieval system