KEGG   Mycolicibacter sinensis: JDM601_3680Help
Entry
JDM601_3680       CDS       T01512                                 

Gene name
mhpF_1
Definition
(GenBank) acetaldehyde dehydrogenase MhpF_1
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00360  Phenylalanine metabolism
mjd00362  Benzoate degradation
mjd00620  Pyruvate metabolism
mjd00621  Dioxin degradation
mjd00622  Xylene degradation
mjd00650  Butanoate metabolism
mjd01100  Metabolic pathways
mjd01120  Microbial metabolism in diverse environments
mjd01220  Degradation of aromatic compounds
Module
mjd_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    JDM601_3680 (mhpF_1)
   00650 Butanoate metabolism
    JDM601_3680 (mhpF_1)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    JDM601_3680 (mhpF_1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    JDM601_3680 (mhpF_1)
   00622 Xylene degradation
    JDM601_3680 (mhpF_1)
   00621 Dioxin degradation
    JDM601_3680 (mhpF_1)
Enzymes [BR:mjd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     JDM601_3680 (mhpF_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh DUF4620
Motif
Other DBs
NCBI-ProteinID: AEF37680
UniProt: F5Z2B3
Position
complement(3887780..3888709)
Genome map
AA seq 309 aa AA seqDB search
MAAKASVAIVGSGNISTDLLYKLLRSEWLEPRWMIGIDPESEGLARARKLGLETSAEGAD
WLLAQDELPDFVFEATSAYVHKAYAPKYEAAGIRAIDLTPAAVGPAVIPPANLHEHVDAP
NVNMITCGGQATIPIVYAVTRAVKEQGGTVPYAEIVASVASVSAGPGTRANIDEFTKTTS
RGVETIGGAQQGKAIIILNPADPPMIMRDTIFCQIPEDVDRDAITKSIHSVVEQVQTYVP
GYRLLNEPQFDEPSLNSGGRAVVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIARE
LATAKAGGA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaaagcctcagtcgcgatcgtcgggtcgggcaacatcagcaccgacctgctg
tacaaactgctgcgctcggagtggctcgagccgcgctggatgatcggtatcgaccccgaa
tccgagggcctggcccgcgcccgcaaactcggtctggagacctcggcggagggggcggac
tggctgctggcccaagatgagttgccggacttcgtcttcgaggccaccagcgcctacgtc
cacaaggcgtacgcgcccaagtacgaggcggccggcatccgggccatcgacctgaccccg
gccgcggtcggcccggcggtgatcccgccggcgaacctgcacgaacacgtcgacgcgccc
aacgtcaacatgatcacctgcggcgggcaggccaccattccgatcgtctacgcggtgacc
cgcgcggtcaaagagcagggcggcacggtgccctatgccgagatcgtcgccagcgtcgcg
agcgtctcggcggggccgggcacccgggccaacatcgatgagttcaccaagaccacctcg
cgcggagtggagaccatcggcggtgcgcaacagggcaaggcgatcatcatcttgaacccg
gccgacccgccgatgatcatgcgcgacaccatcttctgccagattcccgaggacgtcgac
cgcgacgcgatcaccaagtcgatccacagcgtggtcgagcaggtgcagacctacgtgccc
ggctaccggctgctcaacgagccacagttcgacgagccgtcgctgaactccggcggccgc
gcggtcgtcaccaccttcgtcgaggtcgagggcgccggtgattacctgccgccgtatgcg
ggcaacctggacatcatgaccgccgcggcgaccaaggtcggcgaagagatcgcccgcgag
ctggcgaccgcgaaagccggaggggcgtaa

DBGET integrated database retrieval system