KEGG   Mycolicibacter sinensis: JDM601_3694Help
Entry
JDM601_3694       CDS       T01512                                 

Gene name
fadA5
Definition
(GenBank) acetyl-CoA acetyltransferase FadA5
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00071  Fatty acid degradation
mjd00072  Synthesis and degradation of ketone bodies
mjd00280  Valine, leucine and isoleucine degradation
mjd00310  Lysine degradation
mjd00362  Benzoate degradation
mjd00380  Tryptophan metabolism
mjd00620  Pyruvate metabolism
mjd00630  Glyoxylate and dicarboxylate metabolism
mjd00640  Propanoate metabolism
mjd00650  Butanoate metabolism
mjd00900  Terpenoid backbone biosynthesis
mjd01100  Metabolic pathways
mjd01110  Biosynthesis of secondary metabolites
mjd01120  Microbial metabolism in diverse environments
mjd01130  Biosynthesis of antibiotics
mjd01200  Carbon metabolism
mjd01212  Fatty acid metabolism
mjd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mjd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    JDM601_3694 (fadA5)
   00630 Glyoxylate and dicarboxylate metabolism
    JDM601_3694 (fadA5)
   00640 Propanoate metabolism
    JDM601_3694 (fadA5)
   00650 Butanoate metabolism
    JDM601_3694 (fadA5)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    JDM601_3694 (fadA5)
   00072 Synthesis and degradation of ketone bodies
    JDM601_3694 (fadA5)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    JDM601_3694 (fadA5)
   00310 Lysine degradation
    JDM601_3694 (fadA5)
   00380 Tryptophan metabolism
    JDM601_3694 (fadA5)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    JDM601_3694 (fadA5)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    JDM601_3694 (fadA5)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JDM601_3694 (fadA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mjd04147]
    JDM601_3694 (fadA5)
Enzymes [BR:mjd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     JDM601_3694 (fadA5)
Exosome [BR:mjd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   JDM601_3694 (fadA5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AEF37694
UniProt: F5Z2C7
Position
3902786..3903937
Genome map
AA seq 383 aa AA seqDB search
MGNPVIVEATRSPIGKRNGWLSGLHATELLGAVQKALVTKAGIEPGSVEQVISGCVTQYG
EQANNVARQSWLIAGLPEHVGATTIDCQCGSAQQANHLIAGLISVGAIDIGIACGIEAMS
RVGLGENGGGARASSWTIDLPNQFEAAERIAKRRGITRADVDAFGLRSQQRAKQAWDEGR
FDREISPIEAPVIDENKQPTAEWNTVSRDQGLRDTTIEGLTKLNPVLEGGIHTAGSSSQI
SDGAAAVLWMDEDRAKALGLKPRARIVSQANVGAETYYHLDGPVQSTAKVLEKAGMKMGD
IDLVEINEAFASVVLSWAAVHNPDMDRVNVNGGAIALGHPVGSTGSRLITTALHELERTD
KSTALITMCAGGALSTGTIIERI
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatcctgtcatcgtcgaagccactcgaagccccatcggtaaacgtaacggctgg
ctgtcgggtctgcacgccactgaactgctcggtgcggtacagaaggcgctggtcaccaag
gccggtatcgagccgggcagcgtcgagcaggtcatcagcggctgcgtcacccagtacggc
gagcaggccaacaacgtggcccggcaatcctggctgatcgccgggttgcccgagcacgtc
ggcgccaccaccatcgactgccagtgcggcagcgcgcagcaggccaaccatctgatcgcc
ggcctgatctcggtcggcgccatcgacatcggcatcgcgtgcggtatcgaggcgatgagc
cgggtcggcctgggcgagaacggcggtggcgcccgggcgtcgtcgtggaccatcgacctg
cccaaccagttcgaggccgccgagcggatcgccaagcgccgcgggatcacccgcgccgac
gtcgacgcattcgggctgcgctcccagcagcgggccaagcaggcctgggatgaaggccgg
ttcgaccgggagatctccccgatcgaggcgccggtgatcgacgagaacaagcaacccacc
gccgagtggaacaccgtcagccgcgaccagggcctgcgcgacaccacgatcgagggcctg
accaagctgaacccggtgctcgagggtggcatccacactgccggcagctcctcgcagatc
tccgacggcgcggccgcggtgctgtggatggatgaagaccgggccaaagccttgggcctg
aagccgcgggcccggatcgtcagccaggccaacgtcggcgccgagacctactaccacctg
gacggcccggtgcagtccaccgcgaaggtgctcgagaaggccgggatgaagatgggtgac
atcgacctggtcgagatcaacgaggcgttcgcctcggtggtgttgtcctgggctgcggtg
cacaacccggacatggaccgggtcaacgtcaacggcggggcgatcgcgctgggtcacccg
gtgggttccaccggcagccggctgatcaccaccgcgctgcacgagctggagcgcaccgac
aagtcgaccgcgctgatcaccatgtgcgcgggcggggcgctgtccaccggcaccatcatc
gagcggatttag

DBGET integrated database retrieval system