KEGG   Mycolicibacter sinensis: JDM601_3945Help
Entry
JDM601_3945       CDS       T01512                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase Acs
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00010  Glycolysis / Gluconeogenesis
mjd00620  Pyruvate metabolism
mjd00640  Propanoate metabolism
mjd00680  Methane metabolism
mjd01100  Metabolic pathways
mjd01110  Biosynthesis of secondary metabolites
mjd01120  Microbial metabolism in diverse environments
mjd01130  Biosynthesis of antibiotics
mjd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JDM601_3945 (acs)
   00620 Pyruvate metabolism
    JDM601_3945 (acs)
   00640 Propanoate metabolism
    JDM601_3945 (acs)
  Energy metabolism
   00680 Methane metabolism
    JDM601_3945 (acs)
Enzymes [BR:mjd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     JDM601_3945 (acs)
Lipid biosynthesis proteins [BR:mjd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   JDM601_3945 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEF37945
UniProt: F5YSE7
Position
4193573..4195546
Genome map
AA seq 657 aa AA seqDB search
MSRNPDTAPADSPSSYPPSPEFTAHANTGAEAYRAAEHDRLAFWAEQANRLHWATPFTEV
LDYSRAPFARWFADGRLNVAYNCVDRHVAAGHGDRVAIHWAGEPANDARTITYAELLAEV
SRAANALTGLGLVAGDRVAIYLPMIPEAIIAMLACARLGVLHTVVFAGYSAHALRSRIDD
AQAKLVITSDGQFRRGQAAPLKPAVDEALSAAEATSTVEHVLVVRRTGAEVAWTPDRDLW
WHDVVDAASPQHSPEAFEAEQPLFLLYTSGTTGKPKGIVHTSGGYLTQAAYTHYCVFDLK
AATDVFWCTADIGWVTGHTYAVYGPLANGATEVIYEGTPDFPDQHRHFQIIEKYGVTIYY
TAPTLIRTFMKWGRDIPDAHDLSSLRLLGSVGEPINPEAWRWYRRVIGADAVPVVDTWWQ
TETGATMICPLPGVAATKPGAAMTPLPGISARIVDDHGDLVSPNDTGGEPVSGYLVIDAP
WPAMARGIWGDEQRFIETYWSRFAEQGWYFAGDGARYDADGDIWVLGRIDDVMNVSGHRI
STAEVESALVGHAAVAEAAVVGALDEQTGQRICAFVVLAASHSAAGGAIVDELRERVTVE
ISPIARPHKVHVVPELPKTRSGKIMRRLLRDVADGRELGDTSTLVDPSVFDAIRAAD
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
gtgagccggaaccctgacaccgcccccgcagactcgccgtcgtcgtacccaccgtccccc
gagttcaccgctcacgccaacaccggcgccgaggcctaccgtgcggccgaacacgaccgg
ctcgcgttctgggccgagcaggccaaccggctgcactgggcgacgccgttcaccgaggtg
ctcgactactcgcgggcgccgttcgcccgctggttcgccgacggcaggctcaacgtcgcc
tacaactgcgtggaccgccacgtggcggccggtcacggcgaccgggtggcgatccactgg
gcgggcgagccggccaacgacgcccgcaccatcacctatgcggagttgctcgccgaggtg
agccgggcggccaatgcgctgacgggccttggcctggtcgccggtgatcgggtcgccatc
tatctgccgatgatccccgaggcgatcatcgcgatgctggcctgtgcccggctgggggtg
ttgcacaccgtggtgttcgccggctactccgcgcacgcactgcgttcccgcatcgacgac
gcgcaggcgaagctggtgatcacctccgacggacagttccggcgcggccaggccgccccg
ctcaagcccgcggtcgacgaggcgttgagcgcagccgaagcgacaagcaccgtcgagcat
gtgctggtggtgcgccgcaccggtgccgaggttgcctggactcccgaccgcgacctgtgg
tggcacgacgtcgtcgacgccgcatcaccgcagcactcccccgaggcgttcgaggccgag
cagccgctgttcctgctctacacctcggggacgacgggcaagccgaagggcatcgtgcac
accagcggcggttacctgacccaggcggcctacacccactactgcgttttcgacctgaag
gcggccaccgacgtgttctggtgcaccgcagacatcgggtgggtcaccggccacacctat
gcggtgtacgggccgctggccaacggcgccaccgaggtgatctacgagggcacgccggac
ttcccggaccaacaccgccacttccagatcatcgaaaaatacggcgtgacaatctattac
accgcgccgacgctgatccgcacgttcatgaagtggggtcgcgacatccccgacgcccac
gacctgtcgagtctgcggctgctggggtcggtcggtgagccgatcaacccggaggcctgg
cgctggtatcgccgggtgatcggcgcggacgcggtgccggtggtcgacacctggtggcag
accgagaccggagcgacgatgatctgcccgctgcccggcgttgccgcgaccaaaccgggt
gccgcgatgaccccgctgcccgggatttcggcgcgcatcgtggacgaccacggtgatctg
gtgtccccgaacgacaccggcggcgaaccggtgtcgggatacctggtgatcgatgcgccg
tggccggcgatggcccgcggaatctggggggacgagcagcggttcatcgagacgtactgg
tcgcggttcgccgagcagggctggtacttcgccggtgacggcgcccgctatgacgccgac
ggtgacatctgggtgctcggccgtatcgacgacgtgatgaacgtgtccggacaccgcatc
tccaccgccgaggtggagtccgcgctggtcggtcacgccgcggtggccgaagccgccgtg
gtcggcgccctcgacgagcagaccgggcaacggatctgcgcgttcgtggtgctagcggcc
tcgcacagcgcggccggtggcgcgatcgtcgacgagctgcgcgagcgtgtcacggtcgag
atctcgccgatcgcccgcccgcacaaggtccacgttgtcccggagttgccgaagacccgc
agcggcaagatcatgcggcgactgctgcgcgacgtcgccgacggccgcgaactcggtgat
acctcaaccctggtggaccccagcgtgttcgacgcgatccgggcggccgactga

DBGET integrated database retrieval system