KEGG   Methanocaldococcus bathoardescens: JH146_0612Help
Entry
JH146_0612        CDS       T03253                                 

Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
mjh  Methanocaldococcus bathoardescens
Pathway
mjh00020  Citrate cycle (TCA cycle)
mjh00620  Pyruvate metabolism
mjh00720  Carbon fixation pathways in prokaryotes
mjh01100  Metabolic pathways
mjh01120  Microbial metabolism in diverse environments
mjh01200  Carbon metabolism
mjh01230  Biosynthesis of amino acids
Module
mjh_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mjh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    JH146_0612
   00620 Pyruvate metabolism
    JH146_0612
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    JH146_0612
Enzymes [BR:mjh01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     JH146_0612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C RimK GARS_A ATP-grasp_3 ATP-grasp ATPgrasp_Ter ATP-grasp_5 AP_endonuc_2 Oxidored_nitro Glyoxalase_4
Motif
Other DBs
NCBI-ProteinID: AIJ05461
UniProt: A0A076LB98
Position
617821..619326
Genome map
AA seq 501 aa AA seqDB search
MFNKVLIANRGEIAIRIIRACWELGIKTVAVYSEADKRSLHVTLADEAYCIGPAPAAKSY
LNIDAILNVAEKAKVDAIHPGYGFLAENAEFARAVKKAGFEFIGPNPNAIEAMGSKINAK
KIMRKAGVPLIPGSEGAVEDVDEAMEIAEAIGFPVVVKASAGGGGMGMSVAYSKEELKEV
IESARNIAKSAFGDPTVFIEKYLENPRHIEIQLLGDKHGNIIHLGDRECSIQRRHQKLIE
EAPSPIMTEELRERMGEAAIKAGKAINYDSAGTVEFLYENGNFYFLEMNTRIQVEHTVTE
QVTGIDLVKAMIKIAAGEELSIKQEDVKIKGHAIECRINAEDPLNDFVPCPGKIKLYRSP
GGPGVRIDSGVCGGAEIPPYYDSMIAKLITYGNSREEAIARMKRALREYVIVGVTTNIPF
HRAVLEEENFLKGNTSTHYVEQNMHKLREKMVKYTLETRDLYSVVSEKVFEKNKKIAAVV
GGLTMYISQIMKENEKNKKKQ
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgttcaacaaagtgttgattgcaaataggggagaaatagcgattagaattataagagca
tgttgggagttggggattaaaacagttgcagtttattctgaggcagataaaaggtctcta
catgtcactttagctgatgaagcttactgtataggtccagctccagcggcgaagagttat
ctaaatattgatgctattctaaatgttgccgagaaagctaaggtcgatgctatccatcca
ggttatggatttttagctgaaaatgctgaatttgcaagagctgttaaaaaagcaggtttt
gaatttatagggccaaatcctaatgctatagaagcaatgggaagcaaaattaacgctaaa
aaaattatgagaaaggcgggagttcctttaattcctggtagtgagggggcagttgaagat
gttgatgaagcaatggaaatagctgaagctatcggcttccctgtggttgttaaggcttct
gctggcggtggaggaatggggatgagtgtcgcttatagtaaagaagagttaaaagaagtt
atagagtcggcaagaaatattgcaaagagtgcatttggtgacccaacagtgtttattgag
aaatatttagaaaatccaagacatattgagatacagctattgggggataaacatggaaat
attatccatttaggagatagggagtgttctattcaaagaagacatcaaaagttgattgaa
gaagctccatctccaataatgactgaagagttaagagaaagaatgggagaagcggctatt
aaagcagggaaagcaataaattatgacagtgcaggaactgttgagttcttgtatgagaat
ggtaatttctacttcttagagatgaacacaagaattcaggttgaacacacagttaccgag
caggttactggaatagaccttgtaaaggcgatgattaaaatagccgctggagaagagcta
agcataaagcaggaggatgtaaagattaaagggcatgcaattgaatgtagaattaatgca
gaagacccattaaatgactttgttccatgtcctggaaagataaagctatataggtctcca
ggagggccaggggttagaatagatagtggtgtttgtggaggagctgagattcctccatat
tatgattcaatgattgcaaaactcattacctatggtaatagtagggaagaagcaatagca
aggatgaagagggctttaagagaatatgttattgtaggtgtaacaacaaatatcccattc
cacagggctgttttagaggaagagaactttttaaaaggaaatacctcaacccattatgtt
gagcaaaatatgcataaattaagagaaaaaatggttaaatacacattagaaacaagggat
ttatacagtgttgtatcagagaaggtatttgaaaagaacaaaaagatagctgccgttgtt
ggtggtttaacaatgtatatctcccaaattatgaaagaaaatgagaaaaataaaaagaag
cagtaa

DBGET integrated database retrieval system