KEGG   Mycobacterium sp. JLS: Mjls_0201Help
Entry
Mjls_0201         CDS       T00482                                 

Definition
(GenBank) Arylamine N-acetyltransferase
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00633  Nitrotoluene degradation
mjl00983  Drug metabolism - other enzymes
mjl01100  Metabolic pathways
mjl01110  Biosynthesis of secondary metabolites
mjl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mjl00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Mjls_0201
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mjls_0201
   00983 Drug metabolism - other enzymes
    Mjls_0201
Enzymes [BR:mjl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     Mjls_0201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-ProteinID: ABN96014
Position
213342..214187
Genome map
AA seq 281 aa AA seqDB search
MGHMTETAVDTRAYLTRIGYRGAGDPTLATLRALIAAHNRSIPFENLDPLLGTPVADLSA
TALTDKLVYRRRGGYCYEHNGLMGYVLEDLGFGVERIAGRVVWMRRDDTLPAQTHQLLTV
TVPEVSGRYLVDVGFGGQTLSSPLRFETGVEQPTRHEPYRIRDHGEGYVLESLIRGEWRP
LYLFADRPQPLIDLEVGSWYVSTHPASVFVVGLTAALVTDEARVNMRGRHLTVHRAEGSE
QIRFDTAAQVLDALDERFGIDLTDLGDRAAVEQRIHEVLDS
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggggcacatgaccgagaccgctgtcgacacccgggcgtacctcaccaggatcggctat
cggggtgcgggcgatcccacgctcgccacgctgcgggcgctgatcgccgcgcacaaccgg
tcgatcccgttcgagaacctcgacccgctgctgggcacgccggtcgccgacctcagcgcg
accgccctgaccgacaagctcgtgtaccggcgacgcggcggctactgctacgaacacaac
gggctgatgggatatgtgctcgaggatctgggcttcggcgtcgagcggatcgccgggcgg
gtggtgtggatgcgccgcgatgacacgctgcccgcccagacccatcaactcctgacggtg
acggtgccggaggtctccggccgctacctggtcgacgtcggcttcggcgggcagacgctg
tcctcgccgctccgcttcgagaccggtgtcgaacagcccaccagacacgagccgtaccgg
atccgcgaccacggcgagggctacgtactggaatccctcatccggggtgagtggcgtccg
ctgtacctgttcgccgaccggccgcagccgctgatcgacctcgaggtcggcagctggtac
gtctcgacccatcccgcgtcggtgttcgtggtcggcctgaccgccgcgctggtgaccgac
gaggcccgggtcaacatgcggggccgccacctcacggtgcatcgcgccgagggcagtgag
cagatccgattcgacaccgcggcacaggtactcgacgcactcgacgaacggttcggcatc
gacctgacagacctcggcgaccgggccgccgtggagcagcgcatccacgaggtgctcgac
agttag

DBGET integrated database retrieval system