KEGG   Mycobacterium sp. JLS: Mjls_0253Help
Entry
Mjls_0253         CDS       T00482                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00860  Porphyrin and chlorophyll metabolism
mjl01100  Metabolic pathways
mjl01110  Biosynthesis of secondary metabolites
mjl01120  Microbial metabolism in diverse environments
Module
mjl_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mjls_0253
Enzymes [BR:mjl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mjls_0253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: ABN96066
Position
complement(287721..288869)
Genome map
AA seq 382 aa AA seqDB search
MSEPDWAPLTGFRVAVTSARRAEELSALLRRRGATVTSAAAIAMVPLPDDDELRAHTQAL
IDAPPDIVIATTGIGLRGWIAAADGWGVAAELTAALAGARIVSRGPKATGALRAAGLPEE
WSPDSESSREVLRYLLDGGIAGKRIAVQLHGATDDWDPFPEFLDELRAAGADVVPIRVYR
WRPAPRDGDFDQLVAGIAEEKFDAVSFTSAPAVASVLMRATEMGVADRVLTALRTNVHAM
CVGPVTARPLVRLGVPTSAPERMRLGALARHITDELPLLQARTVRVAGHLLEIRGTCVLV
DGVVKSLSPAGMATIRALAHRPGAVVSRTDLLGALPGSGTDTHAVETAVLRLRTALGDKQ
IVSTVVKRGYRLTVDDDLAEAL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcctgactgggcaccgctcaccggattccgggtggcggtgacctccgcccga
cgcgccgaggagctgagcgcactgctgcgccgccgcggcgccaccgtcaccagcgcggcc
gcgatcgcgatggtgccgctgcccgacgacgacgaactgcgcgcccacacccaggcgctg
atcgacgcaccccctgacatcgtgatcgcgaccaccggaatcgggctgcgcggctggatc
gccgctgccgacggctggggcgtcgccgccgaactcaccgcggccctggcgggggcccgc
atcgtctcccgcggccccaaggcgaccggcgcgctccgggccgccggcctgcccgaggag
tggtcaccggattcggagtcgtcccgggaggtgctgcgctatctgctcgacggcggcatc
gccggcaagcgcatcgccgtccagttgcacggcgccaccgacgactgggatcccttcccc
gaattcctcgacgaactgcgggccgcaggcgccgacgtggtgccgatccgggtgtaccgc
tggcgtccggcaccccgcgacggcgacttcgaccagttggtggcgggtatcgccgaggag
aagttcgatgccgtcagcttcacctccgcaccggctgtggcgtcggtgctcatgcgggcc
accgagatgggtgtcgccgaccgggtgctgacggccctgcggaccaacgtgcacgcgatg
tgcgtcggcccggtcaccgcgcgtcccctggtccggctcggggttccgacgtcggcgccg
gagcgcatgcggttgggtgcgctggcccgccacatcaccgacgaacttccactgttgcag
gcccgcaccgttcgtgtggccggacacctgctcgagatccgcggtacctgcgtactcgtg
gacggtgtggtcaaatcgctatccccggccgggatggccaccatccgcgcactcgcgcac
cggcccggcgcggtggtgtcgcgcaccgacctgcttggcgcattgcccggcagcggcacc
gacacccacgccgtcgagaccgcggtgctgcggctgcgaaccgcgttgggcgacaagcag
atcgtgtccacggtcgtcaaacgcggataccggctcaccgtcgacgacgatctggcggag
gccctgtga

DBGET integrated database retrieval system