KEGG   Mycobacterium sp. JLS: Mjls_0446Help
Entry
Mjls_0446         CDS       T00482                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00030  Pentose phosphate pathway
mjl00480  Glutathione metabolism
mjl01100  Metabolic pathways
mjl01110  Biosynthesis of secondary metabolites
mjl01120  Microbial metabolism in diverse environments
mjl01130  Biosynthesis of antibiotics
mjl01200  Carbon metabolism
Module
mjl_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mjl_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:mjl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mjls_0446
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Mjls_0446
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mjl04147]
    Mjls_0446
Enzymes [BR:mjl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Mjls_0446
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Mjls_0446
Exosome [BR:mjl04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Mjls_0446
  Exosomal proteins of colorectal cancer cells
   Mjls_0446
  Exosomal proteins of bladder cancer cells
   Mjls_0446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ABN96258
Position
complement(496179..497594)
Genome map
AA seq 471 aa AA seqDB search
MSEQRPAPHIFVLFGATGDLAKRKLFPGLYRLAAAGRLPEEYAIIGSGRHSPGGDDEFRD
SVGDGLRDSVDDIDDRVLSNLLQSLSFQTSDSDDGSDLAEAVRSARTRLGDGAQTLIYLS
VPPRAMQPMIAMLGREGLAEGARVVVEKPFGTDLDTARELDATLKDVVDEDQVYRIDHFI
GKEAVQNILAVRFANGLIEPAWHRNHLVSVQIDVPEELTIEGRGSFYESTGCFRDMISTH
LCQVLGFVAMEPPVHLDPVSLRNEKAKVFEAMRPLDPDRVVFGQYDGYREEEGVADDSQV
ETFVALEAFIDTERWQGVPFYLRTGKALGATRRTVTLTFRGPPMALFGADDNEHSPNQLV
LELTDSPEFQVRLLAKRPGPDLGLMPLDLSLGVADEDSDDTPLEAYERLLLDVMRGDQTL
FTRADEVDRLWQVCQPVLDAPPQALTYASGSWGPQEALALPGAAGWRLPDA
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaacagcgtcctgccccacacattttcgtgctgttcggcgcgaccggcgatctg
gcgaaacgcaaactgttccccggtctgtaccggctggccgcggcgggacgcctgccggag
gagtacgcgatcatcggatcgggccgccactccccgggcggcgacgacgagttccgcgac
agcgtgggcgacgggttgcgcgactcggtcgacgacatcgacgatcgcgtgctgtcaaac
ctgttgcaaagcttgtcttttcagacctccgacagtgacgacggcagcgacctcgccgag
gccgtccgctccgcccggacgcgactcggcgacggcgcccagacgttgatctacctgtcg
gtcccacccagggcgatgcagccgatgatcgcgatgctgggccgtgaggggctcgccgag
ggtgcacgggtggtcgtcgagaaacccttcggcaccgacctggacaccgcgcgcgaactc
gacgcgacgctcaaggacgtcgtcgacgaggatcaggtctaccgcatcgaccacttcatc
gggaaggaggcggtgcagaacatcctggcggtgcggttcgccaacggcctgatcgaaccc
gcctggcaccgcaaccacctcgtgtcggtgcagatcgacgtccccgaagaactcacgatc
gagggccgcggcagcttctacgagtcgacgggctgtttccgcgacatgatctccacgcat
ctgtgccaggtgctggggttcgtcgcgatggagccgcccgtccacctcgatccggtgtcg
ctgcgcaacgagaaggccaaggtcttcgaggccatgcgaccgctggatcccgaccgcgtg
gtgttcggtcagtacgacggataccgcgaggaggagggcgtcgccgacgattcgcaggtc
gagacgttcgtcgcgctcgaggcgttcatcgacaccgagcggtggcagggcgtgccgttc
tacctgcgcaccggcaaggcgctcggggccacccgacgcaccgtcacgctgaccttccgc
ggcccgccgatggcgctgttcggcgccgacgacaacgagcactcccccaaccaactggtc
ctggaactgaccgactcaccggagttccaggtccggctgctggccaaacgacccggcccc
gacctcgggctgatgccgctcgacctcagtctcggcgtggccgacgaggattccgacgac
accccgctcgaggcctacgagcggttgctgctcgacgtgatgcgcggggaccagaccctg
ttcacccgcgccgacgaggtggaccggctgtggcaggtgtgccagccggtgctcgacgca
ccgccacaggcgctcacctacgcttccggctcgtggggtccgcaggaagcgctggccctg
cccggcgcggcggggtggcggctgccggatgcgtga

DBGET integrated database retrieval system