KEGG   Mycobacterium sp. JLS: Mjls_0672Help
Entry
Mjls_0672         CDS       T00482                                 

Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00860  Porphyrin and chlorophyll metabolism
mjl01100  Metabolic pathways
mjl01110  Biosynthesis of secondary metabolites
mjl01120  Microbial metabolism in diverse environments
Module
mjl_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mjls_0672
Enzymes [BR:mjl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mjls_0672
Exosome [BR:mjl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mjls_0672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD OMPdecase Mob_Pre
Motif
Other DBs
NCBI-ProteinID: ABN96483
Position
724600..725571
Genome map
AA seq 323 aa AA seqDB search
MRQRPRRLRSTPAMRRLVAETSLEPRHLVLPMFVADGIDEPRPISSMPGVVQHTRDSLRR
AAADAVAAGVGGLMLFGVPRDEDKDPRGSIGMDPEGILNVALRDLAKDLGEDTVIMADTC
LDEFTDHGHCGVLDDRGRVDNDATNQQYVKLAVAQAQSGAHVVAPSGMMDGQVAAIRDGL
DGAGHTDVAILAYAAKFASAFYGPFREAVGSSLQGDRRTYQQDSGNAREALREIELDLAE
GADMVMVKPAMSYLDVVRACADISPVPVAAYQISGEYAMISAAAANGWIDLQASALEALT
GIRRAGADIVLTYWAADVAGWLG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcagcgtccgcgtaggttgcgttcgacaccggccatgcgtcggctggttgctgaa
acctccctggagccaaggcatctcgtgctgccgatgttcgtcgccgacgggatcgacgag
ccgcggccgatctcgtcgatgcccggggtggtgcaacacacccgcgactcgttgcgccgc
gcggccgccgacgcggtggccgccggggtgggcgggctgatgctgttcggggtgccccgc
gacgaggacaaggatccgcgcggttcgatcggcatggaccccgagggcatcctcaacgtc
gcgctgcgcgacctcgccaaggacctcggcgaggacaccgtgatcatggccgacacctgc
ctcgacgagttcaccgatcacggccactgcggggtgctggacgaccggggtcgggtcgac
aatgacgcgaccaatcagcagtacgtgaaacttgctgtggcccaggcgcagtcgggtgcc
cacgtggtcgcgccgagcgggatgatggacggtcaggtggccgccatccgcgacgggctg
gacggcgcaggacacaccgacgtggcgatcctggcgtatgcggccaagttcgcctcggcg
ttctacggcccgttccgcgaagccgtcggatcgagtctgcagggcgaccgccgcacctat
cagcaggacagcggcaacgcgcgcgaggctctgcgcgagatcgaactggacctcgccgag
ggcgccgacatggtgatggtgaagccggccatgtcctacctggacgtggtgcgcgcatgc
gccgacatctccccggtgccggtcgcggcgtaccagatctccggtgagtacgcgatgatc
agcgccgccgccgccaacggctggatcgatctgcaggcgtctgccctcgaagcgctcacc
ggtatccggcgggccggtgcggacatcgtgttgacctactgggcggccgacgtggccggc
tggctgggatga

DBGET integrated database retrieval system