KEGG   Mycobacterium sp. JLS: Mjls_1690Help
Entry
Mjls_1690         CDS       T00482                                 

Definition
(GenBank) Alcohol dehydrogenase, zinc-binding domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00010  Glycolysis / Gluconeogenesis
mjl00071  Fatty acid degradation
mjl00350  Tyrosine metabolism
mjl00625  Chloroalkane and chloroalkene degradation
mjl00626  Naphthalene degradation
mjl01100  Metabolic pathways
mjl01110  Biosynthesis of secondary metabolites
mjl01120  Microbial metabolism in diverse environments
mjl01130  Biosynthesis of antibiotics
mjl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mjls_1690
  Lipid metabolism
   00071 Fatty acid degradation
    Mjls_1690
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mjls_1690
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mjls_1690
   00626 Naphthalene degradation
    Mjls_1690
Enzymes [BR:mjl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mjls_1690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C 3HCDH_N TrkA_N adh_short Pyr_redox XdhC_C Met_10 UDPG_MGDP_dh_N NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ABN97480
Position
complement(1787347..1788354)
Genome map
AA seq 335 aa AA seqDB search
MDVRSVADPSPPPGGVVVEVHATGLCRSDWHGWAGHDRGITLPHVPGHELVGVVAEVGAG
VEKWRVGDRVTTPFVCGCGRCQWCLEGQAQVCPDQTQPGFTHWGSFADYVALHAADANLV
AVPDAVVDAAAAGLGCRFATAYRALSARARIRPGEWVTVVGAGGVGLSSVQIAVAFGARV
IAVDREPAALALASRLGAEHTVHADGADVAGRVHELTGGGSHVAVDAVGSAATCADAIHS
LRRRGRHLQVGLLPDVTGHPAVPMDRVIAWELDVLGSHGMASGDYPGMMRLIEAGTLRPQ
AFVERVVGLTEGAALLPSLSVATPAGVTLIDPRLG
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtggatgtccggtccgtggccgacccgtcgccgccgcccggcggcgtggtcgtcgaggtg
cacgccaccggcctgtgccggagcgactggcacgggtgggccggccacgaccgcggcatc
acgctcccccacgtacccggccacgaactggtcggcgtggtggcggaggtcggtgccggc
gtcgagaaatggcgggtcggcgaccgtgtcaccacaccgttcgtctgcgggtgcggccgc
tgccaatggtgcctggaggggcaggcgcaggtgtgtccggaccagacccagccgggattc
acgcactggggttcgttcgccgactacgtggccctgcatgccgccgacgccaacctggtc
gcggtcccggacgccgtcgtcgacgccgccgcggcgggactcggctgccgattcgccacc
gcctaccgggcgctgagcgcacgcgcccggatccgccccggcgagtgggtgacggtcgtc
ggcgccggcggggtggggctgagcagcgtgcagatcgccgtcgcgttcggcgccagggtg
atcgcggtcgaccgggagccggcggcgctcgcgctggcgagccgactgggcgcggagcac
accgtgcacgctgacggcgccgacgtcgcgggccgggtccacgaactcaccggcgggggc
agccatgtcgccgtggacgcggtcggttcagcggcgacgtgcgcggatgccatccacagc
ctgcgccgccgcggacgtcacctccaggtcggtctgctgcccgatgtcaccgggcatccg
gcggtgccgatggatcgggtcatcgcatgggaactcgacgtcctgggcagccacggcatg
gccagcggggactaccccggaatgatgcggctgatcgaggcgggaacgttgcgcccgcag
gcattcgtcgagcgcgtcgtcgggctcaccgaaggcgccgctctcctgccgtcgctgagc
gtcgcgaccccggcgggggtcacgctgatcgacccgcggctcggctga

DBGET integrated database retrieval system