KEGG   Mycobacterium sp. JLS: Mjls_2034Help
Entry
Mjls_2034         CDS       T00482                                 

Definition
(GenBank) adenosylcobyric acid synthase (glutamine-hydrolysing)
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00860  Porphyrin and chlorophyll metabolism
mjl01100  Metabolic pathways
Module
mjl_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:mjl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mjls_2034
Enzymes [BR:mjl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Mjls_2034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 GATase SNO DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ABN97821
UniProt: A3PY44
Position
2141166..2142653
Genome map
AA seq 495 aa AA seqDB search
MTGGALLVAGTTSDAGKSMVVAGLCRLLARKGVRVAPFKAQNMSNNSAVTVDGGEIGRAQ
AMQARAAGLDPSVRFNPVLLKPGSDRTSQLVVRGRVTGTVSATDYITHRDRLADVVADEL
ASLRAEFDVVLCEGAGSPAEINLRRTDLANMGLARRAHLPVIVVGDIDRGGVLAHLFGTV
AVLHPDDQALIAGFVVNKFRGDPTLLAPGLDQLHDLTGRPTYGVIPYSDELWMDTEDSVS
VVAGRTIGRPTPPRGADGLRVAAVRLPRISNSTDIEALACEPGVTVRWVTDPADVADADV
VVLPGTKATVADLQWLRTAGLAEPIAAHAGAGRPLLGICGGFQMLCRHIDDAVESRAGRV
DGLGLLDADIAFAAEKTLRHRTTPLQGYEIHHGQVTRCAADDWAGIGVRRDAVYGTHWHG
LFDNDGFRRAWLADAAAAAGRSGFVVADDIDVSARRDAQLDVMADLLQNHLDLDAALGLV
DAGPPPRPTISTGIT
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcggggcgctgctcgtcgcaggcaccacctccgacgcaggcaagtccatggtg
gtggccgggctgtgccggctgctggcccgcaagggggtccgcgtcgcgccgttcaaggcg
cagaacatgtcgaacaattcggcggtcaccgtcgacggtggcgagatcggccgcgcgcag
gccatgcaggcgcgcgccgcagggctcgacccgagcgtgcggttcaacccggtgctgctc
aaacccggcagtgaccgcacctcgcaactcgtcgtgcgcgggcgcgtgaccggtaccgtc
agcgccacggactacatcacccaccgcgaccggctcgccgatgtggtcgcagacgaactc
gcctctctgagagcggaattcgacgtcgtgctgtgcgagggtgcgggttcgcccgcggag
atcaacctgcgccgcaccgacctggccaacatggggctggcccggcgcgcccacctaccg
gtcatcgtggtcggggacatcgaccgcggcggggtgctggcccacctcttcggcaccgtc
gcggtgctgcatcccgacgatcaggctctgatcgccggattcgtggtcaacaagttccgc
ggggatccgacactgctcgcccccggcctcgaccaactgcacgatctgacgggccgcccg
acctacggtgtgatcccgtacagcgacgaactctggatggacaccgaggattcggtgtcc
gtcgtcgcgggccgcaccatcgggcgcccgacgccgccgcgcggcgccgacggtctccgg
gtggcggcggtgcggctgccgcggatctccaactcgaccgacatcgaggccctggcgtgc
gaacccggggtgacggtgcgctgggtgaccgatccggccgacgtggccgacgcggacgtc
gtagtgctgccgggcaccaaggccaccgtcgccgacctgcagtggttgcgcaccgccgga
ttggcggagccgatcgccgcgcacgccggcgcgggccggccgctgctggggatctgcggc
ggattccagatgctctgccgccacatcgacgatgcggtcgaatcgcgggccgggcgggtg
gacggcctcggtctgctcgacgccgacatcgcattcgccgccgagaagacgttgcggcac
cggacgacaccgctgcagggctacgagatccaccacggccaggtcacccgctgcgccgcc
gacgactgggccgggatcggtgtgcggcgcgacgcggtgtacggcacccactggcacggc
ctgttcgacaacgacggcttccggcgggcctggctcgccgatgccgcggccgcggccggc
cggtccggtttcgtcgtggccgacgacatcgacgtgtccgcgcgtcgcgacgcccaactc
gacgtcatggccgacctgttgcagaaccacctggacctcgacgccgccctgggcctcgtc
gacgccggaccgccaccgcgcccgaccatctccacagggataacctga

DBGET integrated database retrieval system