KEGG   Mycobacterium sp. JLS: Mjls_3353Help
Entry
Mjls_3353         CDS       T00482                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K22316  ribonuclease H / adenosylcobalamin/alpha-ribazole phosphatase [EC:3.1.26.4 3.1.3.73]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00860  Porphyrin and chlorophyll metabolism
mjl01100  Metabolic pathways
mjl03030  DNA replication
Module
mjl_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:mjl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mjls_3353
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Mjls_3353
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mjl03032]
    Mjls_3353
Enzymes [BR:mjl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     Mjls_3353
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     Mjls_3353
DNA replication proteins [BR:mjl03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     Mjls_3353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 RVT_3 RNase_H
Motif
Other DBs
NCBI-ProteinID: ABN99131
Position
complement(3515827..3516924)
Genome map
AA seq 365 aa AA seqDB search
MKVLVEADGGSRGNPGPAGYGSVVWSEDRSSVLAEAKQSIGRATNNVAEYRGLIAGLEEA
ANVGATEVAVSMDSKLIVEQMAGRWRVKHPDLIPLYQRARELAEGFDRVTYSWIPRAANA
RADRLANEAMDAAQGIDPPPRTAAPAASTHTPTSPAGWTGARGEPTRFLLLRHGQTELSV
ERRYSGRGNPALTELGRSQAGAAAAYLAGRGGIDAVITSPLQRAYDTATAAAKTLGLDVT
VDEDLIETDFGAWEGLTFGEASQRDPELHGRWLRDTSVDPPGGESFDTVAHRVRRARNRI
IADHGASTVLVVSHVTPIKTMLRLALNAGEGILYRLHLDLASLSIAEFYPDGGSSVRLVN
QTAHL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggttctcgtcgaggccgacggcggctcgcggggcaaccccggaccggcgggctac
ggctcggtggtctggtcggaggaccggtcgtcggtgctcgccgaggccaaacagtcgatc
ggccgggccaccaacaacgtcgccgagtaccgcgggttgatcgccggtctcgaggaggcc
gccaacgtcggcgccaccgaggtcgcggtgtcgatggactccaaactcatcgtcgagcag
atggcgggccgctggcgggtcaaacaccccgacctgattccgctgtatcagcgggcgcgg
gaactggccgaggggttcgaccgcgtcacgtattcgtggattccgcgggccgccaacgcc
cgcgccgaccggctggccaacgaggcgatggacgccgcgcagggtatcgaccccccgccg
cgcacggccgcccccgccgcgtccacccacacccccacgtcaccggccggctggacgggt
gcgcggggggagccgacacggttcctgctgctgcgccacggacagaccgagctgtcggtg
gagcgccggtactccgggcgcggcaacccggcgctgaccgaactgggccgcagccaggcc
ggcgccgcggccgcctacctcgcgggtcggggcggcatcgacgccgtcatcacctcaccg
ctgcagcgcgcctacgacaccgcgaccgctgccgccaagacgctcggactggacgtcacc
gtcgacgaggatctgatcgagacggatttcggcgcctgggaagggctgacattcggcgaa
gcgtcgcaacgggatccggagctgcacggccgctggctgcgcgacaccagcgtcgacccg
cccggcggggagagcttcgacaccgtcgcccaccgggtgcggcgggcccgcaaccgcatc
atcgccgaccacggcgcctcgacggtgctggtggtctcccacgtcacgccgatcaagacg
atgctgcggctggcgctcaacgccggggaaggcatcctgtaccggctgcacctggatctc
gcctcgctgagcatcgcggagttctaccccgacggtggatcgtcggtgcggctggtcaac
cagaccgcccacctctag

DBGET integrated database retrieval system