KEGG   Mycobacterium sp. JLS: Mjls_3768
Entry
Mjls_3768         CDS       T00482                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00903  Limonene and pinene degradation
mjl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mjl00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mjls_3768
Enzymes [BR:mjl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     Mjls_3768
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Pterin_bind
Other DBs
NCBI-ProteinID: ABN99544
UniProt: A0A5Q5CJK7
Position
3987849..3988685
AA seq 278 aa
MAGRVEGKVAFITGAARGQGRAHAVRLAQEGADIIAVDICKQIDSVRIPLSTPEDLAETA
DLVKGLNRRIYTAEVDTRDFDALKAAVDAGVEQLGRLDIIVANAGIGNGGETLDKTSDGD
WEDMIDVNLGGVWKTVKAGVPHILAGGRGGSIILTSSVGGLKAYPHTGHYVAAKHGVVGL
MRTFAVELGAQNIRVNSVHPTNVNTPLFMNEGTMKLFRPDLENPGPEDMKVVGQMMHTLP
IGWVEPEDIANAVLFLASDEARYITGVTLPVDGGSCLK
NT seq 837 nt   +upstreamnt  +downstreamnt
atggcaggacgggtagaaggcaaagtcgcattcatcacgggtgcggcccgcggacagggc
cgggcccacgcggtgcgactggcgcaggagggcgccgacatcatcgccgtcgacatctgt
aagcagatcgacagcgtccggatccccctgtcgacccccgaggatctcgccgagaccgcc
gatctggtgaagggactcaaccgccgcatctacaccgccgaggtcgacacccgcgacttc
gacgcgttgaaggccgctgtggacgccggtgtggagcagctgggccggctcgacatcatc
gtcgccaacgccggtatcggcaacggcggggagacgctggacaagaccagcgacggcgac
tgggaagacatgatcgacgtcaacctcggcggcgtgtggaagaccgtcaaagccggcgta
ccgcacatcctcgccggcgggcgtggtggttcgatcatcctcaccagctccgtcggcggc
ctcaaggcctatccgcacaccggccactacgtggcggccaaacacggtgtggtgggcctg
atgcggacgttcgccgtcgagctgggggcgcagaacattcgcgtcaactcggtgcatccg
accaacgtcaacacgccgctgttcatgaacgaaggcaccatgaagctgttccgtcccgac
ctggagaacccgggccccgaggacatgaaggtcgtcgggcagatgatgcacacgctgccg
atcggctgggtcgagccggaggacatcgccaacgcggtgctgttcctcgcctccgacgag
gcccggtacatcaccggcgtcacgctgcccgtcgacggcggcagctgcctcaagtaa

DBGET integrated database retrieval system