KEGG   Mycobacterium sp. JLS: Mjls_3859Help
Entry
Mjls_3859         CDS       T00482                                 

Definition
(GenBank) ATP:cob(I)alamin adenosyltransferase
  KO
K00798  cob(I)alamin adenosyltransferase [EC:2.5.1.17]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00860  Porphyrin and chlorophyll metabolism
mjl01100  Metabolic pathways
Module
mjl_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:mjl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mjls_3859
Enzymes [BR:mjl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.17  corrinoid adenosyltransferase
     Mjls_3859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cob_adeno_trans
Motif
Other DBs
NCBI-ProteinID: ABN99635
Position
4088171..4088743
Genome map
AA seq 190 aa AA seqDB search
MAVHLTRIYTRTGDDGTTGLSDFSRVSKNDPRLIAYADCDETNAAIGVAIALGDPPARIA
AVLRQVQNDLFDAGADLSTPVAENPEYPPLRITQPYIDRLESWCDEFNEPLPALTSFVLP
GGTPLSAQLHVARTVARRAERSAWEAVDAHGDTISVLPAKYLNRLSDLLFILSRAANPDG
DVLWKPGTDQ
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgcacctgacccgcatctacacccgcaccggtgacgacgggaccacgggactc
agcgacttcagccgcgtgagcaagaacgaccctcgcctgatcgcctacgccgactgtgac
gagacgaacgccgcgatcggcgtcgcgatcgcgctcggcgatccgcccgcgcgaatcgcg
gccgtgctgcgccaggtccagaacgacctcttcgacgcgggcgcggacctgtccaccccg
gtcgcggagaaccccgagtacccgccgctgcggatcacgcagccctacatcgaccggctc
gagtcctggtgcgacgagttcaacgagccgctacccgcgctgacctcgttcgtcctgccg
ggcgggacaccgttgtcggcgcagttgcacgtcgcgcgcacggtggcgcggcgtgccgag
cggtcggcgtgggaggcggtggacgcgcacggcgacaccatcagcgtcctgcccgcgaaa
tacctcaaccggctgtcggatctgctgttcatcctgtcgcgcgcggccaatcccgacggc
gacgtgctctggaaacccggcaccgatcagtaa

DBGET integrated database retrieval system