KEGG   Mycobacterium sp. JLS: Mjls_4223Help
Entry
Mjls_4223         CDS       T00482                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00360  Phenylalanine metabolism
mjl00362  Benzoate degradation
mjl00620  Pyruvate metabolism
mjl00621  Dioxin degradation
mjl00622  Xylene degradation
mjl00650  Butanoate metabolism
mjl01100  Metabolic pathways
mjl01120  Microbial metabolism in diverse environments
mjl01220  Degradation of aromatic compounds
Module
mjl_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mjls_4223
   00650 Butanoate metabolism
    Mjls_4223
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Mjls_4223
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mjls_4223
   00622 Xylene degradation
    Mjls_4223
   00621 Dioxin degradation
    Mjls_4223
Enzymes [BR:mjl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Mjls_4223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ABN99995
UniProt: A3Q4B8
Position
4460637..4461578
Genome map
AA seq 313 aa AA seqDB search
MPDKAGRKMQVAIVGSGNISTDLLYKLLRSEWLEPRWMIGIDPQSEGLARARTLGLETSH
EGVDWLLARDELPDMVFEATSAYVHRDAAPRYAEAGIRAIDLTPAAVGPGVIPPANLREH
LDAPNVNLVTCGGQATIPMVHAVSRVVGVPYAEIVASVSSASAGPGTRANIDEFTKTTSK
GVETIGGARRGKAIIILNPADPPMIMRDTIFCAIPEDADQDAITASIKEVVAQVQTYVPG
YRLLNEPQFDPPSVNSGGQALVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAAKL
AGASLSASSGGRS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacaaggctggacggaaaatgcaggtcgccatcgtcggatcgggcaatatcagc
accgatctgctctacaagttgttgcgttcggagtggctggagccgcgctggatgatcggg
atcgacccgcagagcgagggtttggcccgcgcccgcacgttggggttggagacctcacat
gagggtgtggactggttgttggccagagacgagttgccggacatggtcttcgaggccacg
agtgcctatgtgcaccgtgatgccgcgccccggtacgccgaggccggtatccgcgcgatc
gatctgacccccgcggcggtgggtcccggggtgatcccgccggcgaatctgcgtgagcat
ctcgacgcgccgaacgtgaacctggtgacctgcggcgggcaagccacgatcccgatggtc
cacgcggtgtcgcgcgtggtcggggtgccctacgccgagatcgtggcgtcggtgtcctcg
gcgtcggcgggaccgggcacccgggccaacatcgacgagttcaccaagaccaccagcaag
ggggtcgagaccatcggcggcgcgcgtcgcggcaaggcgatcatcatcctcaacccggcg
gatccgccgatgatcatgcgcgacaccatcttctgcgcgatccccgaggacgccgaccag
gacgcgatcaccgcctcgatcaaagaggtggtagcccaggtgcagacctacgtgccgggt
taccggttgctcaacgagccgcagttcgatccgccgtcggtgaactccgggggccaggcg
ctggtcacaacattcgtcgaagtggagggtgccggtgactatcttccgccttacgctgga
aacctggacatcatgaccgcggcagcgacgaaggtcggcgaagagatcgccgcgaagttg
gccggcgccagcctttccgcatcatcaggaggccgatcatga

DBGET integrated database retrieval system