KEGG   Mycobacterium sp. JLS: Mjls_5063Help
Entry
Mjls_5063         CDS       T00482                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00071  Fatty acid degradation
mjl00072  Synthesis and degradation of ketone bodies
mjl00280  Valine, leucine and isoleucine degradation
mjl00310  Lysine degradation
mjl00362  Benzoate degradation
mjl00380  Tryptophan metabolism
mjl00620  Pyruvate metabolism
mjl00630  Glyoxylate and dicarboxylate metabolism
mjl00640  Propanoate metabolism
mjl00650  Butanoate metabolism
mjl00900  Terpenoid backbone biosynthesis
mjl01100  Metabolic pathways
mjl01110  Biosynthesis of secondary metabolites
mjl01120  Microbial metabolism in diverse environments
mjl01130  Biosynthesis of antibiotics
mjl01200  Carbon metabolism
mjl01212  Fatty acid metabolism
mjl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mjl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mjls_5063
   00630 Glyoxylate and dicarboxylate metabolism
    Mjls_5063
   00640 Propanoate metabolism
    Mjls_5063
   00650 Butanoate metabolism
    Mjls_5063
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mjls_5063
   00072 Synthesis and degradation of ketone bodies
    Mjls_5063
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mjls_5063
   00310 Lysine degradation
    Mjls_5063
   00380 Tryptophan metabolism
    Mjls_5063
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mjls_5063
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mjls_5063
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mjls_5063
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mjl04147]
    Mjls_5063
Enzymes [BR:mjl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mjls_5063
Exosome [BR:mjl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mjls_5063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABO00828
Position
5310690..5311853
Genome map
AA seq 387 aa AA seqDB search
MGNPVIVEATRSPIGKRNGWLSGLHATELLGAVQKALVEKAGIDPGDVEQLIGGCVTQYG
EQSNNITRVSWLTAGLPEHVGATTIDCQCGSAQQANHLVAGLIATGAIDIGIACGIEAMS
RVGLGANAGPDRSKIRAESWDIDMPNQFAAAERIAKRRGITREDIDRLGFASQAKAKQAW
AENRFDREISPIVAPVLDENKQPTSERAPVSKDQGLRDTTLEGLAQLKPVMEGGIHTAGT
SSQISDGAAAVLWMDEDKAKALGLKPRARIVAQANVGAETYYHLDGPVQSTAKVLEKAGM
KLGDIDLVEINEAFASVVLSWAQVHDADMDKVNVNGGAIALGHPVGSTGARLITTALHEL
ERTGKGTALITMCAGGALSTGTIIERI
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaccctgtcatcgtcgaagccacccgcagtccgatcggaaagcgcaacggatgg
ctgtccggactccacgcgaccgaactgttgggtgcggtgcagaaggctctggtcgagaaa
gccgggatcgatccgggcgacgtcgagcagctcatcggcggctgcgtcacccagtacggc
gagcagtccaacaacatcacccgcgtgagctggctgaccgcggggttgcccgagcatgtc
ggcgccaccacgatcgactgccagtgcgggagcgcccagcaggccaaccacctggtcgcc
ggcctgatcgccaccggcgccatcgacatcggtatcgcctgcggtatcgaggcgatgagc
cgggtcgggctcggcgcgaacgccggacccgaccgctcgaagatccgcgcggagtcgtgg
gacatcgacatgcccaaccagttcgcggccgccgaacgcatcgccaagcgccgcggtatc
acgcgcgaggacatcgaccggctcggcttcgcgtcgcaggccaaggccaagcaggcgtgg
gccgagaaccgcttcgaccgggagatctcgccgatcgtggccccggtgctcgacgagaac
aagcagccgacctccgagcgcgcaccggtgtccaaggaccagggtctgcgcgacaccacc
ctcgaggggctggcccaactgaagccggtcatggaaggcggaatccacaccgcgggcacc
tcctcgcagatctccgacggcgccgccgcggtgctgtggatggatgaggacaaggcgaag
gcgctgggattgaagccgcgtgcccggatcgtggcgcaggccaacgtcggcgcggagacc
tattaccacctcgacggacccgtccagtcgaccgccaaggtgctcgagaaggccgggatg
aagctcggcgacatcgacttggtcgagatcaacgaggcgttcgcgtcggtggtgttgtcg
tgggcgcaggtacacgacgccgatatggacaaggtcaacgtcaacggcggcgcgatcgcc
ctcggacatccggtgggctccaccggtgcccggttgatcaccaccgcgctgcacgaactc
gaacgcaccggtaagggcaccgcgctgatcacgatgtgcgcgggcggggccctgtcgacg
ggcaccatcatcgagcggatctga

DBGET integrated database retrieval system