KEGG   Mycobacterium sp. JLS: Mjls_5367Help
Entry
Mjls_5367         CDS       T00482                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00071  Fatty acid degradation
mjl00280  Valine, leucine and isoleucine degradation
mjl00281  Geraniol degradation
mjl00310  Lysine degradation
mjl00360  Phenylalanine metabolism
mjl00362  Benzoate degradation
mjl00380  Tryptophan metabolism
mjl00410  beta-Alanine metabolism
mjl00627  Aminobenzoate degradation
mjl00640  Propanoate metabolism
mjl00650  Butanoate metabolism
mjl00903  Limonene and pinene degradation
mjl00930  Caprolactam degradation
mjl01100  Metabolic pathways
mjl01110  Biosynthesis of secondary metabolites
mjl01120  Microbial metabolism in diverse environments
mjl01130  Biosynthesis of antibiotics
mjl01212  Fatty acid metabolism
Module
mjl_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mjls_5367
   00650 Butanoate metabolism
    Mjls_5367
  Lipid metabolism
   00071 Fatty acid degradation
    Mjls_5367
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mjls_5367
   00310 Lysine degradation
    Mjls_5367
   00360 Phenylalanine metabolism
    Mjls_5367
   00380 Tryptophan metabolism
    Mjls_5367
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mjls_5367
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mjls_5367
   00281 Geraniol degradation
    Mjls_5367
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mjls_5367
   00627 Aminobenzoate degradation
    Mjls_5367
   00930 Caprolactam degradation
    Mjls_5367
Enzymes [BR:mjl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mjls_5367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 DUF3769
Motif
Other DBs
NCBI-ProteinID: ABO01131
Position
5615533..5616348
Genome map
AA seq 271 aa AA seqDB search
MGDTYESVTIETDGHVAQVTLIGPGKGNAMGPAFWAELPDVFTSLDADPDVRAIVLTGSG
RNFSYGLDLAAMGGTLPGLDAGARSRADFHKTLQKMQGAISAVADCRTPTVASVHGWCIG
GGVDLISAVDIRYASADAKFSVREVKLAIVADVGSLARLPLILTDGHLRELALTGKDIDA
ARAEKIGLVNDVYDDPEASLAAAHATAKEIAANPPLTVHGVKDVLDQQRIARVSESLRYV
AAWNSAFLPSKDLGEAVTAMFQKRPPNFTGE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatacatacgagtcggtgaccatcgagaccgacggccacgtcgcacaggtgacg
ttgatcggccccggtaagggcaacgcgatgggaccggcgttctgggccgaactgcccgac
gtgttcacctcgctcgacgccgaccccgatgtgcgcgccatcgtgctcaccggatcgggc
cgcaacttcagctacggcctcgacctggcggccatgggcggcacgctgcccggcctcgac
gccggcgcccgatcacgggccgatttccacaagacgctgcagaagatgcagggggcgatc
agcgccgtcgccgattgccgcacccccacggtcgcctcggtacacggatggtgcatcggc
ggcggcgtcgacctgatcagcgcggtggacatccgctacgccagcgccgacgccaaattc
tcggtgcgtgaggtcaagctcgcgatcgtcgccgacgtcggctcgctggcccggctgccg
ctgatcctgaccgacggccatctccgcgaactcgccctgaccggcaaggacatcgacgcc
gcgcgtgccgagaagatcggtctggtcaacgacgtgtacgacgatccggaggcctcgctg
gcggccgcgcacgccaccgccaaggagatcgcggcgaacccgccgctgaccgtgcacggc
gtcaaggacgtgctcgatcagcagcgcatcgccagggtgtcggagagcctgcgctatgtg
gcggcgtggaactcggcgttcctgccgtccaaggacctcggcgaagccgtgaccgcgatg
ttccagaagcggccaccgaacttcaccggcgaatag

DBGET integrated database retrieval system