KEGG   Manis javanica (Malayan pangolin): 108383381Help
Entry
108383381         CDS       T06054                                 

Gene name
GUCY2D
Definition
(RefSeq) retinal guanylyl cyclase 1
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00230  Purine metabolism
mjv01100  Metabolic pathways
mjv04740  Olfactory transduction
mjv04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108383381 (GUCY2D)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    108383381 (GUCY2D)
   04740 Olfactory transduction
    108383381 (GUCY2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108383381 (GUCY2D)
Enzymes [BR:mjv01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     108383381 (GUCY2D)
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   108383381 (GUCY2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA Kinase-like
Motif
Other DBs
NCBI-GeneID: 108383381
NCBI-ProteinID: XP_017495330
Position
Unknown
AA seq 1037 aa AA seqDB search
ARARPDLAARLAAARLNHDPVLEGGPRFEVALLSEPCRTPGSLGAVSSALARVSGLVGPV
NPAACRPAELLAQEAGVALVPWGCPGTRAAGTTAPTVTPAADALYALLRSFRWARVALVT
APQDLWVEAGLALSTALRDRGLPVALVTSMQPSDLSGAREALRRVHEGPRVRAVIMVMHS
VLLGGEEQRCLLEAAEELGLADGSLVFLPFDTLHYALSPGPEALAALANSSQLRKAHDAV
LTLTRHCPRGGSVLDSLRRAQEHQELPPDLNVQQVSPLFGTIYDAVFLLAGGVGRAQEAA
GGGWVAGAAVARHIRNAQVSGFCGALGEAEEPSFVLLDTDEAGDQLFATYVLDPTRGSLH
SAGTPVHFPRGGRGPGPDPSCWFDPDIICNGGVEPGIVFIGFLLVVGMGLTGALLAHYVR
HRLLHIRMVSGPNKIILTLDDITFLHPQGGSSRKVVQGSRPSLATHSVSDICSIPSQPQG
SSNIGLYEGDWVWLKKFPGDQHIAIRPATKTAFSKLQELRHENVALYLGLFLAGGPDGAA
PAGEGMLAVVSEHCARGSLHDLLYQRDIKLDWMFKSSLLLDLIKGMRYLHHRGVAHGRLK
SRNCVVDGRFVLKVTDHGHGRLLEAQRVLPEPPRAEEQLWTAPELLRDPALERRGTLPGD
VFSLGIIMQEVVCRSPPYAMLELTPEEVVQRVQSPPPLCRPSVSMDQAPLECIQLMKQCW
AEQPELRPSLDRTFELFKNINKGRKTNIIDSMLRMLEQYSSNLEDLIRERTEELELEKQK
TDQLLTQMLPPSVAEALKMGTTVEPEYFEEVTLYFSDIVGFTTISAMSEPIEVVDLLNDL
YTLFDAIIGAHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMSLDILSAVSSFRMRHM
PEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNMSTVRIL
HALDQGFQTEVRGLTELKGKGSENTYWLVGRQGFNKPIPKPLDLQQGSSNHGISLQEIPP
ERRQKLEKARLSHFSGK
NT seq 3114 nt NT seq  +upstreamnt  +downstreamnt
gcccgcgcccgcccggacctggccgcccgcctggccgccgcccgcctgaaccacgaccct
gtcctggaaggcggcccccgcttcgaggtcgcgctgctgtccgagccgtgccggacgcca
ggctcgctgggggcagtgtcctccgcgctggcccgcgtctctggtcttgtgggtccggtg
aatcctgcagcctgccggccggccgaactactagcccaggaggcaggggtcgcgctggtg
ccctggggctgcccagggacgcgggcggcgggcacgacagctcccacagtaacgccagcg
gcggatgccctctatgccctccttcgctcgttccgctgggcacgggtcgccctggtcacc
gccccccaggacctgtgggtggaggccggactagcactgtccacggcgctcagggaccgg
ggtctgcctgttgccctggtgacctccatgcagccgtcggacctgtccggagcccgggag
gcactgaggagggtccacgaaggacccagagtcagagcagtgatcatggtgatgcactcg
gtgctgctgggcggcgaggagcagcgctgcttactggaggctgcagaggagctgggccta
gctgatggctccctggtcttcctgcccttcgacacgctccactacgccttgtcccccggc
cctgaggccttggcggcgctcgccaacagctcacagcttcgcaaggcccacgatgccgtg
ctcaccctcacgcgccactgtccccggggaggcagcgtgctggacagcctgcgcagggcc
caagagcaccaggagctgccccctgacctcaatgtgcagcaggtgtccccactcttcggc
accatctatgacgccgtcttcttgttggcaggaggcgtgggccgagcacaggaggccgca
gggggtggctgggtggctggagctgctgtggcccgtcacatccggaatgcccaggtctct
ggcttctgcggggccttaggggaagctgaggagccctcttttgtactcctggacacagat
gaggcgggagaccaactgtttgccacttatgtgctggaccccacccggggctctctccac
tccgctgggaccccggtgcatttccctagagggggacgggggccagggcccgacccttcg
tgctggttcgacccagacatcatctgcaatggaggagtggagcctggcatcgtctttatc
ggcttcctcttggtggttgggatggggttgacaggggccctcctggcccattatgtgagg
caccggctacttcacatccgaatggtttccggccccaataagatcatcctgactctggac
gacatcacctttctccacccacaaggaggcagctctcgaaaggtggtccaggggagtcga
ccaagtttggctacccacagcgtgtcagacatttgcagcatccccagccagccccagggt
agctccaacattggcctctatgagggagactgggtttggctgaagaaattcccaggggat
cagcacatagctatccgtccagcaaccaagacagccttctccaagctccaggagctccgg
catgagaacgtggccctctacctagggctcttcctagcggggggaccagacggcgccgcg
cccgctggggaaggcatgctggctgtggtctcagagcattgtgcccggggctccctccac
gacctcctctaccagagagacataaagctggactggatgttcaagtcctccctcctactg
gacctcatcaagggaatgaggtatctgcaccaccgaggtgtcgcccacgggcgacttaag
tcacggaactgcgtggtggacgggaggttcgtgcttaaagtcaccgaccacggccacggg
cgactgctggaagcccagagggtgctaccggagcctcccagagcggaggaacagctatgg
acagccccggagctgcttcgcgacccagcgctggagcgccggggaacgctgcccggcgac
gtcttcagcctgggcatcatcatgcaggaggtcgtgtgccgcagccccccctacgccatg
ctggagctgactcccgaggaagtggtgcagagggtgcagagccccccgccgctgtgtcga
ccctcagtgtccatggaccaagcacccttggagtgcatccagctgatgaaacagtgctgg
gcagagcagccggaacttcggccctccttggatcgcacctttgagctgtttaagaacatc
aacaagggccggaagacaaacatcatcgactcaatgctgcggatgctggagcagtactcc
agtaacctggaggacctgatccgggagcgcacggaagagctggagctggaaaagcagaag
acagaccagctgctcacgcagatgctgcctccgtctgtggctgaagctctgaagatgggg
acaactgtggagcctgagtattttgaggaggtgacactgtacttcagcgacattgtaggc
ttcaccaccatctcagccatgagtgagcccattgaagtggtggacctgctcaatgacctc
tacacactctttgatgccatcatcggggcccatgacgtctataaggtggagacaattggg
gatgcctatatggtggcctcggggctgccccagcggaatgggcagcggcatgcagcagag
atcgccaacatgtcactggacatcctcagtgctgtgagttccttccgtatgcgccacatg
cccgaggtgcccgtgcgcatccgcatcggcctgcactcaggcccgtgcgtggcgggcgtg
gtgggcctcaccatgccacggtactgcctctttggggacacggtcaacacggcctcgcgc
atggagtccactgggctgccgtaccgcatccacgtgaacatgagcactgtgcggattctc
cacgccctagaccagggcttccagactgaggtgcgaggcctcacagagctgaagggcaag
ggctctgagaacacatactggctggtgggcagacaaggcttcaacaagcccatccccaaa
ccgcttgacctgcaacaggggagcagcaatcatggcatcagcctgcaggagatcccaccc
gagaggcgccagaagctggagaaggcaaggctgagccacttctcagggaagtga

DBGET integrated database retrieval system