KEGG   Manis javanica (Malayan pangolin): 108384200
Entry
108384200         CDS       T06054                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04080  Neuroactive ligand-receptor interaction
mjv04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108384200 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108384200 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 108384200
NCBI-ProteinID: XP_017496552
Position
Unknown
AA seq 77 aa
MNLRLCVQALLLLWLSLTAVCGGPLLQPSDGKGMQEGNVRHLVQPRGSRNGAGPLQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgcggctgtgcgtgcaggcgctgctgctgctctggctgtccctgacggcggtg
tgtggaggacccctgctacagccttctgacgggaaggggatgcaggaagggaatgtccgc
cacctggtgcagcccagaggatcgaggaatggagcaggacccttgcagggaggtcggagg
aaattccgccgccagcggccacgcctctcccataagggccccatgcctttctga

DBGET integrated database retrieval system