KEGG   Manis javanica (Malayan pangolin): 108384619Help
Entry
108384619         CDS       T06054                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase, mitochondrial-like
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00071  Fatty acid degradation
mjv00072  Synthesis and degradation of ketone bodies
mjv00280  Valine, leucine and isoleucine degradation
mjv00310  Lysine degradation
mjv00380  Tryptophan metabolism
mjv00620  Pyruvate metabolism
mjv00630  Glyoxylate and dicarboxylate metabolism
mjv00640  Propanoate metabolism
mjv00650  Butanoate metabolism
mjv00900  Terpenoid backbone biosynthesis
mjv01100  Metabolic pathways
mjv01200  Carbon metabolism
mjv01212  Fatty acid metabolism
Module
mjv_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    108384619
   00630 Glyoxylate and dicarboxylate metabolism
    108384619
   00640 Propanoate metabolism
    108384619
   00650 Butanoate metabolism
    108384619
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108384619
   00072 Synthesis and degradation of ketone bodies
    108384619
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    108384619
   00310 Lysine degradation
    108384619
   00380 Tryptophan metabolism
    108384619
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    108384619
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mjv04147]
    108384619
Enzymes [BR:mjv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     108384619
Exosome [BR:mjv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108384619
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 108384619
NCBI-ProteinID: XP_017497229
Position
Unknown
AA seq 148 aa AA seqDB search
MAASPPARRLPWQLHPQQGGSKVLESCLQEADVDFIWEPAGKHAWKEEIKXVDFIWEPAG
IAKEEVKEVYIGNVLQGGEGQAPTRQAVLGAGLHISTPCTTVNKVCVSGMKAIMMASQSL
MCGHQDVMVAGGMESMSNVPYVMNRGGT
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcagcttcacccccagcaaggaggctnccatggcagcttcacccccagcaaggaggc
tccaaggttttggagtcctgcctgcaggaagcagatgttgacttcatctgggaacccgca
ggcaagcatgcatggaaggaggagataaagnatgttgacttcatctgggaacccgcaggg
attgccaaagaagaagtgaaagaagtgtacataggcaatgttctacaaggaggtgaggga
caagcccctacaaggcaggcagtgctgggcgcaggcttacatatttctactccatgcacc
actgtgaacaaagtttgtgtctcaggaatgaaagccattatgatggcctctcagagtctt
atgtgcggacatcaggatgtgatggtggcaggtggcatggagagtatgtccaatgtcccc
tatgtgatgaacagagggggaacg

DBGET integrated database retrieval system