KEGG   Manis javanica (Malayan pangolin): 108385409Help
Entry
108385409         CDS       T06054                                 

Gene name
PLA2G4B
Definition
(RefSeq) cytosolic phospholipase A2 beta isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00564  Glycerophospholipid metabolism
mjv00565  Ether lipid metabolism
mjv00590  Arachidonic acid metabolism
mjv00591  Linoleic acid metabolism
mjv00592  alpha-Linolenic acid metabolism
mjv01100  Metabolic pathways
mjv04010  MAPK signaling pathway
mjv04014  Ras signaling pathway
mjv04072  Phospholipase D signaling pathway
mjv04217  Necroptosis
mjv04270  Vascular smooth muscle contraction
mjv04370  VEGF signaling pathway
mjv04611  Platelet activation
mjv04664  Fc epsilon RI signaling pathway
mjv04666  Fc gamma R-mediated phagocytosis
mjv04724  Glutamatergic synapse
mjv04726  Serotonergic synapse
mjv04730  Long-term depression
mjv04750  Inflammatory mediator regulation of TRP channels
mjv04912  GnRH signaling pathway
mjv04913  Ovarian steroidogenesis
mjv04921  Oxytocin signaling pathway
mjv05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    108385409 (PLA2G4B)
   00565 Ether lipid metabolism
    108385409 (PLA2G4B)
   00590 Arachidonic acid metabolism
    108385409 (PLA2G4B)
   00591 Linoleic acid metabolism
    108385409 (PLA2G4B)
   00592 alpha-Linolenic acid metabolism
    108385409 (PLA2G4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    108385409 (PLA2G4B)
   04010 MAPK signaling pathway
    108385409 (PLA2G4B)
   04370 VEGF signaling pathway
    108385409 (PLA2G4B)
   04072 Phospholipase D signaling pathway
    108385409 (PLA2G4B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108385409 (PLA2G4B)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108385409 (PLA2G4B)
   04664 Fc epsilon RI signaling pathway
    108385409 (PLA2G4B)
   04666 Fc gamma R-mediated phagocytosis
    108385409 (PLA2G4B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    108385409 (PLA2G4B)
   04913 Ovarian steroidogenesis
    108385409 (PLA2G4B)
   04921 Oxytocin signaling pathway
    108385409 (PLA2G4B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108385409 (PLA2G4B)
  09156 Nervous system
   04724 Glutamatergic synapse
    108385409 (PLA2G4B)
   04726 Serotonergic synapse
    108385409 (PLA2G4B)
   04730 Long-term depression
    108385409 (PLA2G4B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108385409 (PLA2G4B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    108385409 (PLA2G4B)
Enzymes [BR:mjv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     108385409 (PLA2G4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 108385409
NCBI-ProteinID: XP_017498332
Position
Unknown
AA seq 820 aa AA seqDB search
MTSCPVGISRPRKGEQRCVVLPCRRCTSFLASEDSLMAPAKVPGTCLLTIRVLQARGLPS
MDLVTPSDCYVTLWLPTASSHRLQTRTVKNSSNPIWNQSFHFRIHSQLKNIVQLQVFDQD
FLTSDDPMLSVLFDVGTLQAGEFRRESFSLNPQGEEQLEVEFRLQSLTDCAEHLVSNGIL
VARELCCLHVQLEEAEDQKESKGRVQLAVPGSFEGPQEASVGAGSFCFHCPACWEQELNV
HVQDAPQEQLKVPLRALPFGQVVRLVFPMSQEPLMRVKLNKEQGPRELAVRLGCGPCAEE
QAFLSRRKQVVARALTQALQLDGDLREDEIPVVAVMATGGGIRAMTSLYGQLAGLRELGL
LDCISYITGASGSTWALANLYEDAEWSQKDLSGPTESLRTQVTKSKLGVLAPKQLRRYQQ
ELAEHARLGYPTCFTNLWALINEALLHDEPHHHKLSDQREALSRGQNPLPIYCALNTKRQ
NLTTFEFGEWCEFSPYEVGFPKYGAFIPSELFGSEFFMGRLMKQLPEPRICFLEGIWSNL
YAANLEDSLYWASEPSQFWDHWAQDRVGLEKQQVPLLKIEEPPSVAGRIAEFFTDLLTQR
PLAQATHNFLRGLQFHKDYFQNPYFSSWKATKLDGLPNQLTPAEPYLCLLDVGYLVNTSC
PPLLRPTRDVDLIISLDYNLGGAFQQLQLLGRFCQEQGIPFPPISPSPEEGHQPQECHLF
LDPDHPEAPAVLHFPLVSDTFREYSAPGVRRTAEEAAAGEVNLSSTDSPYHYSKMTYSQE
DVDKLLHLTHYNISNNREQLLVALREAVQRRRQRGQHQPE
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgacaagttgtcctgtgggcatctctaggcccaggaagggagagcagcgctgcgtggtc
ctcccctgtaggcgctgcacatcgttcctggcttctgaggacagcctcatggctccggca
aaggtacctggaacctgcctgctcaccattcgtgtcctgcaggcccgtgggttgccctcc
atggacctagtgaccccctctgactgctatgtaacactgtggctgcccacggcctctagc
cacaggttgcagacacgcacagtcaagaacagcagcaaccccatctggaaccagagcttt
cacttccgcatccacagtcagctcaagaacattgtgcagctgcaagtctttgaccaggac
ttcctgaccagtgatgaccccatgttgtcagtgctgttcgatgtggggacattgcaggcc
ggggagttccgccgtgagagcttctcactgaaccctcagggtgaggagcagctggaagtt
gaatttcgtctgcagagcttgacggactgtgctgagcaccttgtcagcaatggcatcctg
gtggctcgggagctctgctgcttgcatgttcagctggaggaggcagaggaccagaaggag
tcaaagggcagagttcagcttgcggttcctgggtcctttgagggtccacaggaggcttca
gtgggtgctggctctttctgcttccactgcccggcctgctgggagcaagagctgaatgtt
cacgtgcaggatgccccccaagagcaactgaaggtgcccctgagggccctgccctttggc
caagtggtgaggctcgtcttccccatgtcccaggagcccctgatgagggtgaagctgaat
aaagaacaaggaccaagggagctggctgtgcggcttggctgcgggccctgtgccgaggag
caggccttcctgagcaggaggaagcaggtggtggccagggccctgacgcaggccctgcag
ctggacggagacctgcgggaggacgagatcccggtggtagctgtcatggccactggtggt
gggatccgggcaatgacttccttgtatgggcagctggccggcctgagggagctaggcctc
ttggattgcatctcctacatcacaggggcctcaggctctacctgggctttggccaacctc
tacgaggacgcagagtggtctcagaaggacctgtcagggcccactgagtcactgaggacc
caggtgaccaagagcaagctgggcgtgctggcccccaagcagctgcggcgctaccagcag
gagctggccgagcatgctcgcctgggctatccgacctgcttcaccaacctgtgggccctc
atcaatgaggcactgctgcatgatgagccccatcaccacaaactctcagaccagcgggag
gccctgagtcgtggccagaaccctctgcccatctactgtgccctcaacaccaagaggcag
aacctgaccacctttgaatttggggagtggtgcgagttctccccctacgaggtcggcttt
cccaagtacggcgccttcatcccctctgagctcttcggctccgagttcttcatggggcgg
ctgatgaagcagcttcctgagccccgtatctgcttcctggaaggtatctggagcaaccta
tacgcagccaaccttgaggacagtttatactgggcctcagagcccagccagttctgggac
cactgggcacaggatcgggttggcttggaaaagcagcaagtcccccttctgaagatagaa
gagcctccctcagtggctggcaggatagctgagtttttcactgaccttctgacacagcgc
ccacttgcccaggccacccacaatttccttcgtggcctccagttccataaggattatttc
cagaatccttatttctcctcctggaaagctaccaaactggatgggctccccaaccagctg
acacctgcagagccctacctttgccttctggatgttggctaccttgtcaacactagctgt
ccacccctcctgcgacccactcgggatgtggacctcatcatttcgctggactataacctg
ggtggagcctttcagcagctgcagctcctgggccggttctgccaggagcaggggattcca
ttcccgcccatctcgcccagccctgaggaggggcaccagccgcaggagtgccatctgttc
ttggaccccgaccaccctgaagcccctgctgtgctgcacttccccctggtcagtgacact
ttccgggagtactcagcgcctggggtccggcgcacagctgaggaggcggcggctggtgag
gtgaacctgtcttcaaccgactccccgtaccactactcgaagatgacctacagccaggag
gacgtggacaagctgctccacctgacacattacaatatctccaacaaccgggagcagctg
ctggtggccctgcgtgaggccgtgcagcggcggaggcagcgtgggcagcaccagccggag
tga

DBGET integrated database retrieval system