KEGG   Manis javanica (Malayan pangolin): 108385829Help
Entry
108385829         CDS       T06054                                 

Gene name
GPX7
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00480  Glutathione metabolism
mjv00590  Arachidonic acid metabolism
mjv01100  Metabolic pathways
mjv04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    108385829 (GPX7)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108385829 (GPX7)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    108385829 (GPX7)
Enzymes [BR:mjv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     108385829 (GPX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Soc
Motif
Other DBs
NCBI-GeneID: 108385829
NCBI-ProteinID: XP_017498905
Position
Unknown
AA seq 186 aa AA seqDB search
MVAALVAAWLLLSAVACAQRERDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTD
QHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARHTYSVSFPMFSKVAVI
GTGAHPAFKYLTQTSGKEPTWNFWKYLVTPDGKVVGAWDSTVSVEEIRPQITALVRKLIL
KKREDL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggtggctgcactggtggcggcgtggctgctcctgtcggctgtggcctgcgcgcagcgg
gagcgggacttctacgacttcaaggcggtgaacatccggggcaagctggtgtcgctggag
aagtaccgcgggtcggtttccctggtggtgaacgtggctagtgagtgcggcttcacagac
cagcactaccgggccttgcagcagctccagcgggacctggggccccaccacttcaatgta
cttgccttcccctgcaaccagtttggccagcaggagcctgacagcaataaggagattgag
agcttcgcccgccacacctacagtgtctctttccccatgtttagcaaggttgcagtcatc
ggcactggtgcccaccctgccttcaagtatctgacacagacttctgggaaggagcccaca
tggaacttctggaagtacctagtgaccccagatggaaaagtagtaggggcttgggactca
accgtgtcagtagaggagatcaggccccagatcacagcgcttgtgaggaagctcatcctg
aagaagcgggaagacttatga

DBGET integrated database retrieval system