KEGG   Manis javanica (Malayan pangolin): 108386011
Entry
108386011         CDS       T06054                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
mjv  Manis javanica (Malayan pangolin)
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mjv01002]
    108386011 (ERAP1)
Enzymes [BR:mjv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     108386011 (ERAP1)
Peptidases and inhibitors [BR:mjv01002]
 Metallo peptidases
  Family M1
   108386011 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N FPV060
Other DBs
NCBI-GeneID: 108386011
NCBI-ProteinID: XP_017499130
Position
Unknown
AA seq 942 aa
MLSLSIKRPCATMLFVLSSLLILLTVSTPSWCQSGETASPKASNGTPFPWDKMRLPEHII
PVHYHLMIHANLTTLTFEGTIEIELRASQPTSTIILHSHQLQISKAALKRGGGEKQPEEP
LRVLEYPPHEQIALLAPEPLGVGLPYRVVLEYAGNLSETFHGFYKSTYRTKEGEMRILAS
THFEPTAARMAFPCFDEPAFKASFSIKIRRDPRHLAISNMPLVKSVTVTEELTEDHFDVT
VKMSTYLVAFIISDFKSVSKMTKSRVKVSVYAVPDKINQANYALDAAVTLLEFYEDYFSI
PYPLPKQDLAAIPDFQSGAMENWGLTTYRESALLFDAEKSSASDKLHITLVVSHELAHQW
FGNLVTMEWWNDIWLNEGFAKFMEFVSVSVTHPELKVEDYFFGKCFNVMEIDALNSSHPV
STVAENPAQIQELFDDVSYEKGACILNMLREYLSADAFKSGIVQYLQKYSYKNTRNEDLW
NSMASICPADGTQGMDGFCSNGQRSSLSSHWRREGLDVKTMMDTWTLQKGFPMITITVRG
RTVHMEQEHYRKGSDGGPQTRYLWHVPLTFITSKSDSVHRFLLKTKTDVLILPEEVEWIK
FNVGMNGYYIVHYEDDGWDSLTGLLKGAHTAISSHDRASLINNAFQLVSIGKLSIEKALD
LTLYLKHETEIMPVFQGLNELIPIYKLMEKRDMNEVETQFKAFLIRLLKDLIDKQTWTDS
GSISERMLQSQLLLFACVRRYPPCVQRAEGFFRAWKEANGNLRLPSDVALTVFAVGAQNP
EGWDFLYNKYQSSLSSTEKTQIVFALCVSQDKEKLQWLLDQSFKGDIIKTQEFPHILGTI
GRNPVGYPLAWKFLKENWDKLVQKFGLGSSTIAYVVMGTTDQFSTRAKLEEVKGFFSSLK
ENGSQLRCVQQTIEAIEENIRWMDKNFDKIRVWLQNEKLELL
NT seq 2829 nt   +upstreamnt  +downstreamnt
atgctatctctgtccatcaaacggccgtgtgcaaccatgttatttgtactctcctctctg
ttgattctcttaactgtgtcaacaccttcctggtgtcagagcggtgaaactgcatctcca
aaagctagtaacgggacaccatttccttgggataaaatgcgacttcctgagcacatcatc
ccagttcattaccatctcatgatccatgcgaatctcaccactctaaccttcgagggcacc
atagaaatagaactcagagccagccagcccaccagtaccatcatcctgcatagtcaccag
ctgcagatatctaaggcggccctcaagaggggaggtggagagaagcagcctgaagaaccg
ctgagagtcctggaatacccacctcacgagcaaattgcccttctggcccccgagcctctg
ggtgttgggctcccgtacagggtggtccttgagtatgctggcaatctttctgagacattc
cacggattttacaagagcacctacagaaccaaggaaggggaaatgaggatacttgcatca
acacactttgaacctactgcagccagaatggcctttccctgctttgatgaacctgccttc
aaagcaagtttttcaatcaagatcagaagggacccaaggcaccttgccatttccaatatg
ccactggttaaatctgtgacagttactgaagaactcacagaagaccattttgatgtcact
gtgaagatgagcacctacctggtagccttcattatttcagatttcaagtctgttagcaag
atgaccaagagcagagtcaaggtttctgtgtatgctgtgcccgacaagataaatcaggcc
aattatgcactggatgctgcagtgactcttctggaattttatgaggattatttcagcatt
ccatatcccttacccaaacaagatcttgctgctattcctgactttcagtctggtgctatg
gaaaactggggactgacaacatacagggaatctgctctgttgtttgatgcagaaaagtct
tctgcatcagataagcttcacatcacactggttgtgtcccatgaactcgcccaccagtgg
tttgggaaccttgtcactatggaatggtggaatgatatttggctaaatgaaggatttgcc
aagtttatggagtttgtgtctgtcagtgtgactcatccagaactgaaagttgaggattat
ttctttggcaagtgttttaatgtgatggagatagatgcattaaattcttcacaccctgtg
tccacagttgcagagaatcctgctcagattcaggagttatttgatgatgtttcttatgaa
aagggagcttgtattctgaatatgttaagagaatatcttagtgccgatgcatttaaaagt
ggtattgtgcaatatctccagaagtatagctataaaaacacaagaaacgaggacctgtgg
aatagtatggcaagtatttgccctgcagatggcacacaagggatggacggcttttgctct
aatggtcaacgctcgtctttatcctcacactggcgacgggaaggccttgatgtgaaaacc
atgatggacacctggaccctgcagaagggctttcccatgataaccatcaccgtgcgaggg
aggacagtgcacatggagcaggagcactacaggaagggatctgatggtggtccccaaacc
aggtacttgtggcatgttccattgacattcattaccagcaaatcagactcagtccataga
tttttgctgaagacaaaaacagatgtgcttatcctcccagaagaggtggaatggatcaaa
tttaatgtgggaatgaatggctattacatagtgcattatgaggacgatggctgggattct
ttgactggccttttaaaaggagcccacacagcaatcagcagtcatgaccgggccagtctc
attaacaatgcatttcagcttgtcagcattggaaagctatcaattgaaaaagccttggat
ttaaccctgtacttgaaacatgaaactgaaattatgcctgtgttccaaggtttgaatgag
ctgatacctatatataagttaatggagaaaagagatatgaatgaagtggaaactcaattc
aaggcctttctcatcaggctgctgaaggacctcattgataagcagacctggacagacagc
ggctccatctcagagcgaatgctgcagagtcagctcctcctcttcgcctgcgtgcgccgg
tacccgccctgtgtacagagggcggaaggcttcttcagagcgtggaaggaagccaacgga
aatctcaggctgcccagcgatgtggccttgacagtatttgctgtgggggcccagaaccct
gaaggatgggattttctttataataaataccagtcatctttgtccagtaccgagaaaaca
caaattgtatttgcactctgtgttagccaagataaggaaaagcttcagtggctactagat
caaagctttaagggagatataataaaaactcaagagtttccacatattcttggaactatt
ggcagaaacccagtgggatatccattggcctggaaatttctgaaggaaaactgggacaaa
cttgtacaaaagtttggacttggctcatctaccatagcctacgtggtaatgggaacaaca
gatcaattctctacaagagcaaagcttgaagaggtaaaaggattcttcagctctttgaaa
gaaaatggttctcagctccgctgtgtccaacaaacaattgaagccattgaggaaaacata
cgttggatggataagaattttgataaaatcagagtgtggctacaaaatgaaaagcttgaa
ctgctctaa

DBGET integrated database retrieval system