KEGG   Manis javanica (Malayan pangolin): 108387232Help
Entry
108387232         CDS       T06054                                 

Gene name
DHX8
Definition
(RefSeq) ATP-dependent RNA helicase DHX8 isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108387232 (DHX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mjv03041]
    108387232 (DHX8)
Enzymes [BR:mjv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     108387232 (DHX8)
Spliceosome [BR:mjv03041]
 Complex C
  Other components
   Step II factors
    108387232 (DHX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C DEAD AAA_22 T2SSE AAA_19 Flavi_DEAD AAA_30 AAA_16 PhoH ABC_tran Sigma54_activ_2
Motif
Other DBs
NCBI-GeneID: 108387232
NCBI-ProteinID: XP_017500931
Position
Unknown
AA seq 1230 aa AA seqDB search
MAVAVAMAVAVSGTELGPAEELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKN
TTFDTFKASLVKNGAEFTDSLISNLLRLIQTMRPPAKPSTSRDPVVKPKTEKEKLKELFP
VLCQPDNPSVRTMLDEDDVKVAVDVLKELEALMPSAAGQGKQRDTEHRDKTKKKKRSREQ
DRDRDRDRDRDRDRDRDRDRDRDREREHKRRHRSRSRSHSRTRERNKGKSRYRSRSRSQS
PPKDRKDRDKYVERSLDRWRDKHVDRPPPEEPAIGDIYNGKVTSIMQFGCFVQLEGLRKR
WEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNR
RRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKWEIKQMIAANV
LSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDG
SLSQAAMMQSALAKERRELKQAQREAEMDSIPMGLNKHWVDPLPDAEGRQIAANMRGIGM
MPNDIPEWKKHAFGGNKASYGKKTQMSIIEQRESLPIYKLKEQLVQAVHDNQILIVIGET
GSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFED
CTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQD
MKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLT
EPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPP
GSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGR
AGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPP
METLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVS
MLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQAR
SLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQ
QVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLS
KQKKQQRLEPLYNRYEEPNAWRISRAFRRR
NT seq 3693 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggccgtggctatggcggtggctgtaagcgggacagagctaggccccgcggaa
gaactcgctaagctcgagtatctttctttggtgtcgaaggtttgcaccgagctggacaat
cacttggggatcaacgacaaggatctggctgaatttgtgatcagtcttgctgaaaaaaat
accacctttgatacttttaaggcttctctggtcaaaaatggtgcagaattcacggattct
cttattagtaacttgctgcgtctcatacagaccatgcggcctccagcaaagccttctacc
agcagagatccggttgttaaacccaaaactgagaaagaaaagctgaaagaactcttccca
gtcctttgtcaaccagacaacccttctgttcggaccatgctggacgaggatgatgtgaaa
gttgctgtggatgtcctgaaagaactggaggccttaatgcccagtgcagcaggccagggg
aagcaaagagacactgagcaccgggacaagacaaagaagaagaagcggagccgagagcaa
gatcgagaccgagacagagatagagaccgagacagagatagagaccgagaccgagaccga
gaccgagaccgagaaagagagcacaagaggagacaccggtcccgctctcggtcacattcc
aggacccgggagagaaataaagggaagtctagataccggtccaggagcagaagtcagagt
ccccccaaagaccggaaagaccgagacaagtatgtggagagaagtctggacagatggcgg
gataagcatgtggaccgccctcccccagaagagcccgccattggggacatttacaatggc
aaagttaccagcataatgcagttcggatgctttgtacagctggagggactaaggaagcgg
tgggaaggcctagtgcacatctctgagctccggcgggaaggccgtgtggccaatgtggct
gatgtggtgagcaaaggccagagggtcaaggtcaaagtgctgtccttcacggggaccaag
accagtctgagcatgaaggatgtggatcaagagacaggagaagatctaaacccaaatcga
cgacgaaaccttgtcggggagaccaatgaggaaacttcaatgaggaatccagacagacct
actcacctctcccttgtcagtgcccctgaagtagaggacgactcactggagcgcaagcgc
cttacccgcatctctgacccggagaagtgggagatcaaacagatgattgctgccaatgtc
ctttccaaagaagaatttccagactttgatgaagagaccggcattctccctaaggtggat
gacgaagaagatgaggaccttgagattgaactggttgaggaagagcctccattcctgaga
gggcacaccaagcagagcatggacatgagccctattaaaatcgttaagaacccggatggc
tccctctcccaagcagcaatgatgcagagcgctttggccaaagaaaggcgggaactcaag
caagcccagcgggaagctgagatggattctattcccatgggactcaataaacactgggtt
gaccctctgcctgatgcggaaggcaggcagattgctgccaacatgaggggtattgggatg
atgcctaacgacattcctgaatggaagaagcatgcttttgggggaaacaaagcttcttac
ggaaaaaagacccagatgtcaatcattgagcaaagagagagcctgcccatttacaaactg
aaggagcagctggtccaggctgtccacgacaatcagatcttgattgttattggtgagaca
ggatctgggaagacaacacagatcacccagtacctggcggaggcaggctacacttccagg
ggcaagattggatgtacccagcccagaagagtggcagccatgtcagtggccaaaagagtg
tcggaggagtttggttgttgcttaggccaagaggtgggctacaccattcggtttgaggac
tgcaccagccctgaaacagtcatcaagtacatgacagacggaatgttgctccgagagtgc
ctgattgaccccgacctcactcagtacgcgatcatcatgttggatgaggcccacgagagg
acaattcacacagatgtgctctttggattgttgaaaaagacggttcagaaacggcaggat
atgaagctgattgtcacttcagccaccttggatgcagtgaagttttcccaatatttctat
gaagctcccatcttcaccatcccaggtcgaacatatccagtggaaatactgtacacaaag
gaacctgagacagattatctggatgccagcttgatcactgtcatgcagatccatttaaca
gaaccaccaggggatatcctggtcttcctgactggtcaggaagagatcgacactgcttgt
gagatcctgtatgaaagaatgaaatccctgggacctgatgttccagagttgattattctc
ccagtgtactctgctcttcccagtgagatgcagacccgaatcttcgatccagctccacct
ggcagcagaaaggtcgtgattgccaccaacattgcagagacatctctgactattgatggc
atctactatgtggtggaccctggatttgtgaagcagaaagtttacaattccaagacaggg
atcgaccagctcgtggtgactcctatttctcaggctcaggcaaagcaacgagctggcaga
gctgggagaacaggcccagggaagtgttacaggctctacacagaacgcgcctaccgagat
gaaatgctgaccaccaatgtgccagaaatccagagaaccaacttagcaagcacagtgctc
tcactcaaggccatgggcatcaatgacctgctgtcctttgatttcatggatgccccacca
atggaaactttgatcacagccatggagcagctgtacacactgggggccctggatgatgag
ggcctgcttactcgcctgggccgcaggatggcagaattccctctggagccaatgctgtgt
aaaatgttgatcatgtctgtgcatctgggctgcagtgaggaaatgctgactatcgtgtcc
atgttgtctgtgcagaacgtcttctacaggcccaaggataaacaagcccttgcagatcag
aagaaggccaaattccaccagactgaaggggaccacctcaccctgctggctgtgtacaac
tcctggaagaataacaagttctccaacccatggtgttacgagaactttatccaggctcgt
tctctgcgccgggcccaggacattcgcaagcagatgttaggcataatggacagacacaag
ctagatgtggtctcttgtggcaagtccacggtccgagtgcaaaaggccatctgcagtgga
ttcttccgaaatgctgccaagaaagacccacaggagggttaccggacactgatcgaccag
caggtggtctacatccacccttccagtgctctcttcaaccggcagccagaatgggtggtg
taccacgagctggtgctgaccacaaaggagtacatgcgtgaggtcaccaccattgaccct
cggtggctcgtggagtttgctcctgccttctttaaggtctctgacccaaccaagctaagc
aaacagaagaagcagcagcgtcttgaacccttatacaaccgctatgaggaacccaacgcc
tggagaatatcccgggccttccggcggcgctga

DBGET integrated database retrieval system