KEGG   Manis javanica (Malayan pangolin): 108387965Help
Entry
108387965         CDS       T06054                                 

Gene name
HSPA8
Definition
(RefSeq) heat shock cognate 71 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv03040  Spliceosome
mjv04010  MAPK signaling pathway
mjv04141  Protein processing in endoplasmic reticulum
mjv04144  Endocytosis
mjv04213  Longevity regulating pathway - multiple species
mjv04612  Antigen processing and presentation
mjv04915  Estrogen signaling pathway
mjv05134  Legionellosis
mjv05145  Toxoplasmosis
mjv05162  Measles
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108387965 (HSPA8)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108387965 (HSPA8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108387965 (HSPA8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108387965 (HSPA8)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    108387965 (HSPA8)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    108387965 (HSPA8)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    108387965 (HSPA8)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    108387965 (HSPA8)
  09172 Infectious disease: viral
   05162 Measles
    108387965 (HSPA8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108387965 (HSPA8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mjv01009]
    108387965 (HSPA8)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mjv03041]
    108387965 (HSPA8)
   03009 Ribosome biogenesis [BR:mjv03009]
    108387965 (HSPA8)
   03110 Chaperones and folding catalysts [BR:mjv03110]
    108387965 (HSPA8)
   04131 Membrane trafficking [BR:mjv04131]
    108387965 (HSPA8)
   03051 Proteasome [BR:mjv03051]
    108387965 (HSPA8)
   03029 Mitochondrial biogenesis [BR:mjv03029]
    108387965 (HSPA8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mjv04147]
    108387965 (HSPA8)
Protein phosphatases and associated proteins [BR:mjv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     108387965 (HSPA8)
Spliceosome [BR:mjv03041]
 Complex B
  Other components
   Prp19 complex
    108387965 (HSPA8)
 Complex C
   Prp19-CDC5 complex
    108387965 (HSPA8)
Ribosome biogenesis [BR:mjv03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    108387965 (HSPA8)
Chaperones and folding catalysts [BR:mjv03110]
 Heat shock proteins
  HSP70 / DNAK
   108387965 (HSPA8)
Membrane trafficking [BR:mjv04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    108387965 (HSPA8)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    108387965 (HSPA8)
Proteasome [BR:mjv03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    108387965 (HSPA8)
Mitochondrial biogenesis [BR:mjv03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    108387965 (HSPA8)
Exosome [BR:mjv04147]
 Exosomal proteins
  Proteins found in most exosomes
   108387965 (HSPA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR HORMA MetOD2
Motif
Other DBs
NCBI-GeneID: 108387965
NCBI-ProteinID: XP_017501836
Position
Unknown
AA seq 646 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN
SLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELE
KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagggacctgccgttggcattgatcttggcaccacctactcttgtgtgggtgtc
ttccagcacgggaaagtggaaataattgccaatgatcagggaaaccgaaccaccccaagt
tatgtcgcctttactgataccgaacgattgatcggtgatgctgccaagaaccaagttgca
atgaaccccactaacacggtttttgatgccaagcgtcttataggacgtagatttgatgat
gcagttgtccaatcagatatgaagcattggcccttcatggtggtgaatgatgctggcagg
cccaaggtccaagtggaatacaagggagagacaaaaagtttctatccggaggaggtgtca
tctatggttttgacaaagatgaaggaaattgcagaagcttatctagggaagactgttacc
aatgctgttgtcactgtacctgcttatttcaatgactctcagcgtcaggcaaccaaagat
gctggaactattgctggtctcaatgtactcaggatcatcaatgagccaactgctgctgct
attgcttatggcttagacaaaaaggttggagctgaaaggaacgtgcttatctttgactta
ggaggtggcacttttgatgtgtccatcctcactattgaagatggaatctttgaggtcaaa
tctacagctggagacacccacttaggtggagaagattttgacaaccgaatggtcaaccat
ttcattgccgagttcaagcgcaagcataagaaggacatcagtgagaacaagagggctgtc
cgtcgtctccgcactgcttgtgagcgggctaaacgcacgctctcttccagtacccaggcc
agtattgagattgactcactctatgaaggaattgatttctatacctccattacccgtgcc
aggtttgaagaactcaatgctgacctattccgtggcactctggatcccgtggagaaagcc
ctgcgggatgctaagctagacaaatcccagatccatgatattgtcctagtaggtggttct
acccgaatccccaagattcagaaacttctgcaggacttcttcaatggaaaagagctgaat
aagagcatcaaccctgatgaggctgttgcttatggtgccgctgtccaggcagccattctg
tctggagacaaatctgaaaatgttcaagatttgctgctgttggatgtcacgcctctttcc
cttggcattgagactgctggtggggtcatgacagtcctcatcaagcgcaatacaaccatt
cctaccaagcagacacagaccttcactacctactctgacaaccagcctggtgtgctcatt
caggtttatgaaggtgagcgtgccatgaccaaggataacaacctgcttggcaagttcgaa
ctcacaggcataccacctgcccctcgtggtgttcctcagattgaagtcacttttgacatt
gatgcgaatggcatcctcaatgtctctgctgttgataagagtacaggaaaagagaacaag
atcactatcactaacgacaaagggcgtttgagcaaggaagacattgagcgcatggtccag
gaagctgagaaatacaaagctgaagatgagaagcagcgggacaaggtgtcttccaagaat
tcacttgaatcttatgcattcaacatgaaagcaacagttgaagatgaaaaacttcaaggg
aaaatcaatgatgaggataagcagaaaattcttgacaagtgtaatgaaattatcaactgg
cttgataaaaaccagactgcagagaaggaagaatttgaacatcaacagaaagagttggag
aaagtctgcaaccccatcattaccaagctgtaccagagtgcagggggcatgccaggagga
atgcctgggggcttccctgggggtggagctcctccatctggaggtgcctcctctgggcct
accattgaagaggttgattaa

DBGET integrated database retrieval system