KEGG   Manis javanica (Malayan pangolin): 108394735Help
Entry
108394735         CDS       T06054                                 

Definition
(RefSeq) lysine-specific demethylase 4C-like
  KO
K06709  [histone H3]-trimethyl-L-lysine9/36 demethylase [EC:1.14.11.66 1.14.11.69]
Organism
mjv  Manis javanica (Malayan pangolin)
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mjv03036]
    108394735
Enzymes [BR:mjv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.66  [histone H3]-trimethyl-L-lysine9 demethylase
     108394735
    1.14.11.69  [histone H3]-trimethyl-L-lysine36 demethylase
     108394735
Chromosome and associated proteins [BR:mjv03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    108394735
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 108394735
NCBI-ProteinID: XP_017511955
Position
Unknown
AA seq 295 aa AA seqDB search
MELVKCLMCSNPIVFQCTCRRDMVKISMDIFVRKFQPDRYQLWKQGKDIYTIDHTKPTPE
STPEVKAWLQRRRKVRKASRSSQCTSSHSKRPKSEEDEEVSAAVSGAEGPTPDPDQDDLK
VRNKPEGASKLGNTEAPSEEETSASRMQLDQNSPGNSCISTSLKEEIKTEDDRAYAVIPP
LNPSEVDDSISSGHVKFEESEPPKLPWPKSPESWSSVAESNSVLTEEEESDVESRGSGLE
HGEVPAVPTGERNGFKVPSRIEGETKTAKSWRHPLSKPPARSPMTLVKQQAASDE
NT seq 886 nt NT seq  +upstreamnt  +downstreamnt
atggagctagtgaagtgtttaatgtgctccaaccccattgtgtttcagtgcacctgcagg
agagacatggtgaaaatttcaatggatatctttgtgaggaaatttcaaccagacagatac
cagctttggaagcaaggaaaggatatatacactattgatcacacaaagcctactccagaa
tctacccctgaagtaaaagcatggctgcagaggagaaggaaagtaagaaaagcatccagg
agctcccagtgtacaagttctcactcaaagaggcctaagagtgaggaggatgaggaagtc
tcagctgcagtcagtggggcagagggccccactcccgacccagaccaggatgacctcaag
gtcaggaacaagccggaaggagcctcgaagctggggaacacagaagcaccttcggaagaa
gagacctctgctagcaggatgcagctggatcagaattcaccaggaaatagctgcataagc
acatctctaaaagaggaaataaaaactgaggatgaccgagcctatgctgtaatcccacct
ttgaatcccagtgaggttgatgattccatatctagtggtcatgtgaagtttgaggaatca
gagccacccaagcttccttggccaaagtcacctgagtcgtggtcctcagtggcagagagt
aacagtgtgttgacagaggaagaagagagtgatgtggagagccgtgggagtggccttgaa
catggtgaagtcccagcagtccccactggagagagaaatggcttcaaagtccccagtaga
atagagggagaaaccaaaactgctaaaagttggcgccacccacttagtaagcctccggca
agatctccaatgactctggtgaagcaacaggcagcaagtgatgaag

DBGET integrated database retrieval system