KEGG   Manis javanica (Malayan pangolin): 108397210Help
Entry
108397210         CDS       T06054                                 

Definition
(RefSeq) 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase
  KO
K07431  sterol 12-alpha-hydroxylase [EC:1.14.18.8 1.14.14.139]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00120  Primary bile acid biosynthesis
mjv01100  Metabolic pathways
mjv03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    108397210
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    108397210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mjv00199]
    108397210
Enzymes [BR:mjv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.139  5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase
     108397210
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.8  7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase
     108397210
Cytochrome P450 [BR:mjv00199]
 Cytochrome P450, animal type
  CYP8 family
   108397210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 108397210
NCBI-ProteinID: XP_017516007
Position
Unknown
AA seq 501 aa AA seqDB search
MVLWSLVLGALLVATAGCLCLLGLLRQHRPQEPPLDKGSVPWLGHAMAFRKNMFEFLKCM
RAKHGDVFTVQLGGQYFTFVMDPLSFGPILKDVQRKLDFVKYAEKLVLKVFGYGSIQGDY
RMIHSASTKYLMGNGLEELNRVMLESLSLVILGPMGHSPDASCWREDGLFHFCYKILFKA
GYLSLFGYMKDKEQGLLHAEELFMQFRKFDRLFPRFVYSLLWPQEWLEIRRLQRLFHRML
SVEHNLEKDSISSWMSHMLQFLREHGVALDMQDKFNFMMLWASQGNTGPTCFWALMFLLK
HPEAMQAVRKEATQVLGKARLKTGQSFDLEVSALHHTPVLDSVVEETLRLGAAPTLLRVV
HGDHTLQMASGQEYLLRSGDIVALFPYLSVHLDPDIHPEPTAFKYDRFLNPNGSRKVDFY
KAGKKVHHYTMPWGSGVSICPGRFLAISEVKLFVLLMVTYFDLELVDPDTPVPPVDPQRW
GFGTTQPGHEVLFRYRLKPAE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctggagtctggtgctaggagccctacttgtggccactgcagggtgcctatgt
ctgctagggctgctccggcagcacaggccccaggagccccctctggataagggctctgtg
ccctggctcggccatgccatggctttccggaagaatatgtttgaatttctgaagtgcatg
agggccaagcatggggacgtgttcacagtgcagctagggggccagtacttcacctttgtc
atggaccccctctcctttggccccattcttaaggatgtgcaaagaaaacttgactttgtg
aagtatgcagaaaaactggtgctaaaggtgtttggatatggctcgatacagggagactac
cggatgatccactcagccagcaccaagtacctcatggggaatggcttggaggaactcaac
agagtcatgctggagagcctgtccttggttatactggggcccatgggccacagtccagat
gccagttgctggcgtgaggatggcctctttcacttctgctacaagatcttgttcaaggcc
ggctacctgagcttgtttggctacatgaaggacaaggagcagggcctgctacatgcagag
gagttattcatgcagtttcgtaagtttgaccgcctatttcccaggtttgtttactccctg
ctgtggccccaggagtggctagaaatccgcaggctccagcgtctcttccacaggatgctc
tctgtggaacacaacttggagaaggacagcataagcagctggatgtcccatatgctgcag
ttcctgagggagcatggtgtggcccttgacatgcaagacaagttcaacttcatgatgctc
tgggcctcccaggggaacacggggcctacctgtttctgggccctcatgttcctcctgaag
cacccagaagccatgcaggctgtgaggaaggaggccacccaagtcctggggaaggccagg
ctgaagaccgggcagtcctttgacttagaggtcagtgccctgcaccacaccccagtgctg
gacagcgtggtggaggagactctgcggctgggggctgcgcccaccttgctccgggtggtg
catggggaccataccctgcagatggccagcgggcaggagtacctgctccgcagtggcgat
atcgtggccctcttcccttacctctcagtgcacctggaccctgacatccaccccgagccc
actgccttcaagtatgatcgtttcctcaatcccaacggcagccgaaaagtggacttctac
aaggcgggcaagaaagtccaccactataccatgccgtggggttctggtgtctccatctgc
cctgggaggttcttggccatcagcgaggtgaagctctttgtcctgctcatggtcacatac
tttgacctggagctggtggaccctgacacgcctgtgcctcccgtggacccccagcgctgg
ggctttggcaccacgcagcccggtcacgaggtgctcttccgctaccgcctgaagcctgcc
gagtga

DBGET integrated database retrieval system