KEGG   Manis javanica (Malayan pangolin): 108397455
Entry
108397455         CDS       T06054                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
mjv  Manis javanica (Malayan pangolin)
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mjv03036]
    108397455 (ANKRD53)
Chromosome and associated proteins [BR:mjv03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    108397455 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3
Other DBs
NCBI-GeneID: 108397455
NCBI-ProteinID: XP_017516389
Position
Unknown
AA seq 487 aa
MLSFQDAPAGAAVLAAAGPPEARKWRRSPSSDLPPYLLPPTSHNLRADSRRVDEWNQGAI
GSYQLFAAALGNLEWLQFCLNQDHGKIAADDKGFTAIHFAAQSGQLACLQVLVEEYKFPV
DLPTNSGQTALHLVIHGDNKSMALPCIHYLLKQGADINPQTCNGSTPLHLAAQEGLLSCV
KILVQNGANVHIQDGVGCKPIDYCKIWNHRVCARFLKDAMWKQDKKDFACEMGKLKKLKD
QLALMKQDYLTEYQKEHQILKEADFKKWLHCKLPLQSTKQEPSAPCRSIAFSETPNHQGL
GPPKSFHPSLEAHLRQTPRPRMQPLVIPKPIYTKSTVRQPKLWNISNNPARSPTTQIGYP
QGSRLAVHPDLSSEHDFRSFLDVSSDGHGGTQLRTVAGNQVAPVPQLPFEVIVRELYPSV
RPYRMKVPQGFCSLSLSNVPRKRRLGDDSSWTDTLAMNLRETFDDAFLAAVRAHQGSPTL
PSPKPSP
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgctgagtttccaggatgcgcctgccggcgcggcggtgctagcagcggcagggcccccg
gaggcgcgcaagtggcgcaggtcacccagctctgacctgccgccttacttgctccccccc
acttcccacaatctccgcgctgactctagacgggtggatgagtggaaccagggggcgatt
ggcagctaccagttgttcgcagccgcgctgggcaacctagaatggttacagttctgtctg
aaccaggaccatgggaaaatcgctgctgatgacaagggtttcactgccatccactttgca
gcccagagtggccagcttgcatgtctgcaggtcttagtggaggagtacaagtttcccgtg
gacctgcccaccaacagtggccagacagccctgcaccttgtcatccatggggacaacaag
tccatggccctcccctgcattcactatctacttaagcagggggcagacatcaacccccaa
acatgcaatggctccacgcccctgcacctggcagcccaggagggcctgctgagctgtgtg
aagatcctcgtgcaaaatggcgccaatgtccatatccaagatggtgtgggctgcaagccc
atcgactactgcaaaatatggaaccaccgtgtctgtgcccggttcctgaaggatgccatg
tggaaacaggacaagaaggactttgcctgtgagatggggaaactgaagaagctcaaggac
cagctggccctcatgaagcaggactacctgactgagtatcaaaaagagcaccaaattcta
aaagaggctgatttcaagaaatggctccattgcaagctgccgctccaaagcaccaagcaa
gagcccagtgccccatgccggtctattgccttctccgagacccccaaccaccagggattg
gggcctcccaaaagcttccacccttccctggaggcacacctgcgacagacaccacggcct
aggatgcagcccttggtgatacccaagcccatttatacaaagtccacggtcaggcagccc
aagttgtggaatatcagtaacaaccctgccagatcccccaccacccagattggctaccca
cagggcagccgcctggctgtgcatccagacctcagctcggagcacgacttccgcagcttc
ctggacgtgagttctgatggacatggtgggacacagctgcgcacggtggctggcaaccag
gtggcccctgtgccccagctgcctttcgaggtgatagtccgtgagctgtacccttcagtg
cggccctacaggatgaaggtgccccagggcttttgctctctcagcctgagtaatgtgcct
cggaaacggcgcttgggtgatgacagctcctggacggacaccctggccatgaacctgcgt
gaaacatttgacgatgccttcctggcagctgtgagagcccatcaagggtcccctactctg
ccctcccccaagccctccccataa

DBGET integrated database retrieval system