KEGG   Manis javanica (Malayan pangolin): 108398385
Entry
108398385         CDS       T06054                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
mjv  Manis javanica (Malayan pangolin)
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mjv01002]
    108398385 (ADAMTS13)
Enzymes [BR:mjv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     108398385 (ADAMTS13)
Peptidases and inhibitors [BR:mjv01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   108398385 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 TSP1_spondin ADAM_spacer1 Reprolysin_3 TSP1_CCN Reprolysin_4
Other DBs
NCBI-GeneID: 108398385
NCBI-ProteinID: XP_017517843
Position
Unknown
AA seq 1416 aa
MSVLHPQGSCVCGFLTSAFFLLGCWGRSDFQQRFLQALKPEEVTSYFGPDGSLKGRPPSP
RLRRQAVGSVLHLELLVAVGPDVYQAHQEDTQRYVLTNLNMGSELLRDPSLGAQFRVHLV
KMVILTQPEDAPSITANITASLLSVCEWSRTVNPQDDMDPGHADLVLYITRFDLELPDGN
RQVRGVTQLGGACSSFWSCLITEDTGFDLGVTIAHEIGHRARCVRDPPGPQSDPAGRPPE
AHPGLRYGADEQCRVAFGPAAVACTFTRGHLDMCQALSCHTDPLDQSSCSRLLIPLLDGT
ECGVEKWCSKGRCHSLEELAPVGAVHGHWSPWGSPSACSRSCGGGVVTRRRQCNNPRPAF
GGRACTGADLQAEMCNTQACEGTQLEFMSEQCAQTDQKPLQLSPGSTPFYRWGAAVQYSQ
GDPLCQLMCWAIGESFIVRRGDRFLDGTRCVPSGRREDGALSLCVSGSCRTFGCDGRMDS
QQVRDMCQVCGGDNSTCSLQKGSFTGGRAREYVTFLTVTPNLTSIYVINQRPLFTHLAVR
IRGRYIVAGTSSISPSTTYPSPLEDSRVEYKVALAEDRLPRLEEIRIQGPTREDMELQVY
RRYGEEYGDLTHPDITFTYFQPKQQQAWAWAAVRRSCSVSCGSGLRWVTYSCLDRARNQW
VEAAQCRGHPQPAAWQESCVREPCPAYWAAGDFGQCSASCGGGLREREVRCMEAQGGLLR
MLPPARCRALAQQPAEVETCNSQPCPGRQEGSGACSSACGADLDARNVTCVQGADGLEAP
VTAGPCSTDGRLPALEPCVAVACAPAWGHLDPQSPGEGATPPLDSASLGARVTHVWTALV
GPCSVSCGRGLMELHFACMDSTLRTPVQEELCDQASKPGSRQEVCQAAPCPARWETRALA
PCPVTCGGGQVPLAVRCVRQDRGHPVPLPHSKCWPLPRPSPLEDCSLEPCPARWQYKLAA
CSVSCGGGVVQRILYCARAHGVDRDEEILPDTRCQGLPRPQQQEACSPEPCPPRWKITSL
GPCSASCGLGTATRSVACVQLDRGQDTEVDGAACAALARPQASIPCVIADCTYRWHVSAW
TQCSASCGDGIQRRHDACLGPQAQAPVPADFCQHLPKPATVRGCWAGPCAGQGTPSPVSQ
EEATAPGQTTAAPAGASLAWPQPWAHSLPPAVQPPGLLPGPQESTAEFSACGQQHLEPTG
TIDMRGPGQADCAVAIGRPLGEVVTLHVLESSLNCSAGEMLLLWGRLTWRKTCRRLTGMT
FSSKANTLVVRQRRLQPGGGIVLRYRSRPAPGPSHKECDVQLFGPRGEITSPSMIPGRRS
TGGCRVFINVAPRARIAIHALATNMSMGNDAAYILIRDIHSLRTTTFRGQQALYWESEGS
QAEMEFSQGFLEAHSRLRGQYWTLGSGTPEPGWALP
NT seq 4251 nt   +upstreamnt  +downstreamnt
atgagcgtgcttcacccccaggggagctgtgtgtgtgggtttctcacttctgccttcttt
ctcctgggctgctggggacgctccgatttccagcagcggtttcttcaggctttgaagccg
gaggaagtgacttcctactttggccctgatggttccctaaaaggacgtcctccttcccct
cgactccgcagacaggctgtgggaagcgtcctgcatctggagctgctggtggccgtgggc
cccgatgtctaccaggcccaccaggaggacacacagcgctatgtgctcaccaatcttaac
atggggtcggaactgctgagggacccatccctgggggctcagttccgagtgcatctggtg
aagatggtcatcctgacccagcccgaggatgccccgagtatcacggccaacatcactgca
tcactgctaagcgtctgtgagtggagcaggacagtcaacccccaggatgacatggatccc
gggcatgccgacctggtcctctacatcaccaggtttgacctggagttgcctgatggtaac
cggcaggttcggggggtcacccagctggggggtgcctgctcctctttctggagctgcctc
atcactgaggatactggcttcgatctgggggtcaccatcgcccatgagattgggcacagg
gcgcgttgtgtgcgggacccgccggggccgcagtccgatcccgcggggcgtcctcccgag
gcacacccgggcctccgctacggcgccgacgagcagtgccgcgtcgcctttggccctgca
gcagtcgcctgcactttcaccagggggcacctcgacatgtgccaggctctctcctgccac
acagaccctctggaccaaagcagctgtagtcgcctcctcattcctctgctggacgggacg
gagtgtggtgtggagaagtggtgttccaagggtcgctgccactccctggaggagctggcc
cctgtgggggcagtacacgggcactggtccccctggggctcccccagtgcgtgctcccgc
tcctgtggagggggtgtggtcaccaggaggcggcagtgcaacaaccccagacctgccttt
ggggggcgtgcgtgcacaggtgctgatctccaggctgaaatgtgcaacacccaggcctgc
gaggggacccagctggagttcatgtcggagcagtgcgcccagactgaccagaagccgctg
cagctctccccaggcagcacccccttctaccgctggggcgctgctgtgcagtacagccaa
ggggaccctctgtgccaactcatgtgctgggccatcggcgagagcttcattgtgaggcgt
ggggacaggttcctggatgggacccggtgtgtgccaagtggccggcgggaggacggggcc
ctgagcctgtgtgtgtcgggcagctgcaggacattcggctgtgatggcaggatggactcc
cagcaggtgcgggacatgtgccaggtgtgtggaggggacaacagcacgtgcagcctccag
aaaggctcgttcacaggtggaagggccagagagtatgtcactttcctgacagtcaccccc
aacctgaccagtatatacgtcatcaaccagaggcctctgttcacgcacttggcggtgagg
atccgagggcgctacattgtggctgggacttcgagcatctcccccagcaccacctatccc
tccccactggaggacagccgcgtggagtacaaagtggcccttgctgaagaccggctgccc
cgcctggaggagatccgcatccagggccccacccgggaagacatggagctccaggtttac
aggcgctatggcgaggagtacggggacctcacccacccagacatcaccttcacctacttc
cagcctaagcagcagcaggcctgggcatgggccgccgtgcggaggtcctgctcggtgagc
tgtgggtcaggactgcgctgggtgacctacagctgtctggaccgggccaggaaccagtgg
gtggaggctgcccagtgcagagggcacccacagcctgcagcctggcaggagtcctgcgtc
cgcgagccctgccctgcctactgggcggctggagactttggccagtgcagcgcctcgtgc
gggggtggcctgcgggagcgggaggtgcgctgcatggaggcccagggcggcctcctgagg
atgctgcccccggcccggtgcagggccctggcccagcagccagctgaggtggaaacctgc
aactcacagccctgccctggcaggcaggaggggtcaggcgcatgctcatccgcttgtgga
gcagacctggacgcacggaatgtgacgtgcgtgcagggggcagatggcctggaggcacca
gtgactgcggggccctgctccacagatggcaggctgcctgccctcgagccctgtgtggct
gtggcgtgtgccccggcctggggccatctggacccccagtctccaggggagggggctaca
ccccccttggacagtgccagcctgggggctcgtgtgacgcacgtgtggactgccctggtg
gggccgtgctctgtctcctgtggtcgaggtctgatggagctgcattttgcatgcatggac
tccaccctcaggactcctgttcaggaagagctgtgtgaccaggcaagcaagcctggaagc
cggcaggaggtctgccaggctgccccgtgcccagctcggtgggagacccgagccttggca
ccatgcccagtgacttgtggagggggtcaggtgccactggctgttcgctgtgtgaggcag
gaccgtggccaccccgtccccctgcctcactccaagtgctggccactgccccggcccagc
ccccttgaggactgcagcctggagccctgccctgccaggtggcagtacaagctggcggcc
tgcagcgtgagctgtgggggaggcgtcgtgcagaggatcctgtactgtgcccgggcccac
ggggtggacagagacgaggagatcctgccagatactcggtgccaggggctgcctcgccca
cagcagcaggaggcctgcagcccggagccctgcccacccagatggaaaatcacgtccctt
ggtccatgctcagccagctgtggcctcggcactgccacacgctctgtggcctgtgtgcag
ctcgaccgaggccaggatacagaggtggacggggcggcctgtgcagctctggcgcggcca
caggccagcatcccttgtgtcattgctgactgtacctatcggtggcatgtcagcgcctgg
acacagtgctctgcctcctgcggggatggcatccagcgccggcatgatgcctgccttgga
ccccaggcccaggcgcctgtgccagctgacttctgccagcacttgcccaagccagcgaca
gtgcggggctgctgggctggaccctgtgctgggcaggggacccccagcccagtgtcccaa
gaggaagccactgctccaggccagaccacagctgcccctgctggtgcttccctggcatgg
ccccagccctgggcccacagcctgcccccagctgtccagccaccgggactcctgccaggg
ccccaagaaagcacagctgagttcagtgcgtgtggccagcagcaccttgagccaacagga
accattgacatgcgaggcccagggcaggctgactgtgcagtggccatcgggcggcccctg
ggcgaggtcgtgaccctccatgtccttgagagttccctcaattgcagcgctggggagatg
ctgctgctttggggcaggctcacgtggaggaagacgtgcaggaggctgaccggcatgact
ttcagctccaaagccaacacgctagtggtgaggcagcgccgcctgcagccaggcggcggc
attgtgctgcggtataggagccggcctgccccaggaccctcccacaaagaatgtgatgtg
cagctgtttggacctcggggtgaaatcacgagcccctcaatgattccaggcaggaggagc
acggggggctgccgtgtcttcatcaatgtggctccaagggcgcggatcgccatccatgcc
ttggctaccaacatgagcatgggaaatgatgccgcctatatcctgatccgggacatccac
agcctgaggaccacaacattccgtggacagcaggcgctctactgggagtcagagggtagc
caggctgagatggagtttagccagggcttcctggaggctcattccagactgcggggccag
tactggaccctcggatctggaacacccgagccgggctgggccctgccctag

DBGET integrated database retrieval system