KEGG   Manis javanica (Malayan pangolin): 108399175Help
Entry
108399175         CDS       T06054                                 

Gene name
MARS2
Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00450  Selenocompound metabolism
mjv00970  Aminoacyl-tRNA biosynthesis
mjv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    108399175 (MARS2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    108399175 (MARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mjv01007]
    108399175 (MARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mjv03016]
    108399175 (MARS2)
Enzymes [BR:mjv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     108399175 (MARS2)
Amino acid related enzymes [BR:mjv01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   108399175 (MARS2)
Transfer RNA biogenesis [BR:mjv03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    108399175 (MARS2)
 Prokaryotic type
   Other AARSs
    108399175 (MARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 DUF5600
Motif
Other DBs
NCBI-GeneID: 108399175
NCBI-ProteinID: XP_017519270
Position
Unknown
AA seq 593 aa AA seqDB search
MLRISALRLLGHKRKSRVSLLEYCRPRCYSSGPRLARDDARDARAYFTTPIFYVNAAPHI
GHLYSALLADALCRYRRLRIPSAAATRFSTGTDEHGLKIQQAAAAAGLAPTELCNRVSAQ
FQQLFREAGISSTDFIRTTEVRHQVAVQHFWEALKARGLLYKGLYEGWYCASEECFLPEA
KVTRQPGPSGDSCPVSLESGHPVSWTKEENYIFRLSQFREPLQRWLRDDPQAITPEPFQR
AVLQWLEEELPDLSVSRRRSHLYWGIPVPGDDSQTVYVWLDALVNYLTVIGYPDAEFKSW
WPTTSHIIGKDILKFHAIYWPALLLGAGISPPHRIYVHSHWTVCGQKMSKSLGNVVDPRI
CLERYTVDGFRYFLLRQGVPNWDCDYYDEKVVKLLDSELADALGGLLNRCTANRINPSGT
YPAFCTACFPSEPGLVGPSVRAQTEDYALVRAVAILPKQVADHYDNFQIYKALEAVSSCA
RQTNGFIQRHAPWKLNWESPVDALWLGTVLHVALECLRVFGTLLQPVTPSLADKLLSRLG
VSATERSLGELHFLPRFYGCPCPFEGRRLGPETGLLFPRLDQSRAWLLKAHRT
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaatttctgccttgcggctgctgggacacaaaaggaaaagtagggtctcgctt
ttggagtactgtaggccccgctgctacagttcaggccctcgccttgcccgcgacgatgct
cgggacgcgcgcgcctacttcacgacgccaattttttacgtaaatgcggcgccgcacatc
gggcacctgtactcggcgctgctggcggacgccttgtgccgctaccgtcgcctgcgaatt
cccagcgctgccgccacacgattctccactggtaccgacgagcacggcttgaaaatccag
caggcagccgccgctgcgggcctggccccgaccgagctgtgcaaccgagtttctgcccag
ttccagcagcttttccgggaagctggcatctcctccaccgacttcatccgcaccaccgag
gtccggcatcaggtagcggtgcagcatttctgggaggcgctgaaggctcggggtctgctg
tacaaggggctctatgaaggttggtattgcgcctccgaagagtgcttcctgcctgaggcc
aaggtcactcggcagccaggcccttcgggggattcgtgtcctgtgtctctcgagagcggg
catcctgtgtcctggaccaaagaagaaaactacattttcaggctttctcagttccgagag
ccgctccagcggtggctgcgggacgaccctcaggcaatcacacctgagcccttccagcgc
gcagtccttcagtggctggaggaggagcttccagacctttccgtctctcgcaggaggagt
cacttgtactggggcattccagtgcctggagacgattcgcagaccgtctacgtatggctg
gatgccttggtcaactaccttactgtaatcggctacccagatgctgagttcaaatcttgg
tggccaaccacctctcatatcataggcaaggacattcttaaattccatgctatctattgg
cctgccctcctcttaggggcaggcataagcccaccacaccgcatctatgtgcactcccac
tggacggtgtgtggacagaaaatgtctaagagcttaggcaacgtggtggatcccaggatt
tgccttgaacgctatactgtggatggttttcgctactttctcctacgacagggcgtcccc
aactgggattgtgattactatgatgaaaaggtggttaaattgctggattccgagctggca
gatgctttgggaggtctcttgaacagatgcactgccaacagaataaatccttctgggacc
tatccggccttctgcactgcctgctttcccagtgagccagggttggtggggccatcagtt
cgtgcccagacagaggactatgctctggttagagcagtggccattttgcccaagcaggtc
gctgaccactatgataactttcagatttataaggctctggaggcagtgtccagttgtgcc
cggcaaactaatggctttatccaaaggcatgcaccgtggaagttgaactgggagagccct
gtggatgctctctggctgggtactgtgctgcatgtggccctggaatgtttgcgagtcttt
ggaactttgctccagcctgtcaccccaagcctagctgacaagctgttgtccaggttgggg
gtctctgccacagagaggagccttggagagctccatttcttgcctcgattctatggatgt
ccatgcccttttgaagggaggaggctgggacctgaaactgggctcttgtttccaagactg
gaccagtccagggcttggctgctgaaagcccataggacctag

DBGET integrated database retrieval system