KEGG   Manis javanica (Malayan pangolin): 108401168Help
Entry
108401168         CDS       T06054                                 

Definition
(RefSeq) arylamine N-acetyltransferase 1-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00232  Caffeine metabolism
mjv00983  Drug metabolism - other enzymes
mjv01100  Metabolic pathways
mjv05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    108401168
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    108401168
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    108401168
Enzymes [BR:mjv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     108401168
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 108401168
NCBI-ProteinID: XP_017522416
Position
Unknown
AA seq 277 aa AA seqDB search
MNIEAYFERIGYKNPGNKLDLGTLTDILQHHIRAIPFENLNIHCGQYMDLGLEAIFYQIV
RRNRGGWCLQVNHLLYWALTAIGFDTTMLGGNVYSTPTSKYSDDMIHILLQVTIDGRNYI
ADVGFGRSYQMWQPLELISGKDQPQWYLDQIRREQYIPNQEFLNSDLLEKNKYRKIYSFT
LEPRTIKDFEFVNETLQTSPKSVFTSKSFCSLQTTDGVHCLVGFTLTSRKYNYEDNMDLV
EFKTLNEEEIKEELKNIFNISLEGKLVPKHGDRFFTI
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaacatagaagcatattttgaaagaattggttataagaaccctgggaacaaactggac
ttgggaacattgactgacattcttcagcaccacatccgagccattccctttgagaatctt
aatatccattgtgggcaatacatggacttgggcttggaggccattttttatcaaattgtg
aggaggaaccggggtgggtggtgtctccaggtcaatcatcttctgtactgggctctgacc
gcaatcggttttgacaccacaatgttgggtggcaatgtttatagcacccccaccagcaaa
tatagcgatgatatgattcacatcctgctgcaggtgaccattgatggcaggaactacata
gccgatgtcgggtttggacgctcttaccagatgtggcagcctctggagttaatctctggg
aaggatcagcctcagtggtacctggaccaaatcagaagggagcagtacattccaaaccag
gaatttcttaattctgatctcctggaaaagaataaataccgaaaaatctactcttttact
cttgaacctcgaacaattaaagattttgagtttgtgaatgaaacccttcagacctctcca
aaatctgtgtttaccagcaagtcattctgttctttgcagaccacagatggagtccactgc
ttagtgggcttcaccctcacctctaggaaatacaattatgaggacaatatggatttggtg
gagtttaagacactgaatgaagaggaaataaaagaagagctgaaaaacatatttaatatt
tccttggagggaaagcttgtccctaaacatggtgatcgattttttaccatttag

DBGET integrated database retrieval system