KEGG   Manis javanica (Malayan pangolin): 108401438Help
Entry
108401438         CDS       T06054                                 

Gene name
FASLG
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv04010  MAPK signaling pathway
mjv04014  Ras signaling pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04068  FoxO signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04210  Apoptosis
mjv04217  Necroptosis
mjv04650  Natural killer cell mediated cytotoxicity
mjv04722  Neurotrophin signaling pathway
mjv04932  Non-alcoholic fatty liver disease (NAFLD)
mjv04940  Type I diabetes mellitus
mjv05142  Chagas disease (American trypanosomiasis)
mjv05143  African trypanosomiasis
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05162  Measles
mjv05163  Human cytomegalovirus infection
mjv05164  Influenza A
mjv05165  Human papillomavirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05200  Pathways in cancer
mjv05205  Proteoglycans in cancer
mjv05320  Autoimmune thyroid disease
mjv05330  Allograft rejection
mjv05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    108401438 (FASLG)
   04010 MAPK signaling pathway
    108401438 (FASLG)
   04068 FoxO signaling pathway
    108401438 (FASLG)
   04151 PI3K-Akt signaling pathway
    108401438 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108401438 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108401438 (FASLG)
   04217 Necroptosis
    108401438 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    108401438 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108401438 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108401438 (FASLG)
   05205 Proteoglycans in cancer
    108401438 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    108401438 (FASLG)
   05330 Allograft rejection
    108401438 (FASLG)
   05332 Graft-versus-host disease
    108401438 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108401438 (FASLG)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    108401438 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108401438 (FASLG)
   05162 Measles
    108401438 (FASLG)
   05164 Influenza A
    108401438 (FASLG)
   05161 Hepatitis B
    108401438 (FASLG)
   05160 Hepatitis C
    108401438 (FASLG)
   05168 Herpes simplex virus 1 infection
    108401438 (FASLG)
   05163 Human cytomegalovirus infection
    108401438 (FASLG)
   05165 Human papillomavirus infection
    108401438 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    108401438 (FASLG)
   05143 African trypanosomiasis
    108401438 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108401438 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mjv04147]
    108401438 (FASLG)
   04052 Cytokines and growth factors [BR:mjv04052]
    108401438 (FASLG)
   04090 CD molecules [BR:mjv04090]
    108401438 (FASLG)
Exosome [BR:mjv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   108401438 (FASLG)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Tumor necrosis fators
   108401438 (FASLG)
CD molecules [BR:mjv04090]
 Proteins
  108401438 (FASLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF Lectin_N
Motif
Other DBs
NCBI-GeneID: 108401438
NCBI-ProteinID: XP_017522865
Position
Unknown
AA seq 276 aa AA seqDB search
MQQPWDYPCPPIYWVDSGTSSRWVSPGPVLPSAPSVPGRPGQRRPPPPPPPPPALPPLPP
LPPPPLEKRRDRSTGLCLLVLFFMVLVTLVGLGLGMFQLFHLQKELAELREATSQRHVAS
SLEKQIGPSNPSSENRELRKVAHLTGKPNTRSIPLEWEDTYGITLVSGVKYKKGSLVIND
TGLYFVYSKVYFRGQSCNNWPLNHKVFMRNSKYPQDLVLMEGKMMNYCTTGQMWARSSYL
GAVFNLTSADHLYVNVSELSLVNFEESKTFFGLYKL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagccctgggattacccatgtcccccgatctactgggtggacagcggaaccagc
agccgctgggtgtctccaggcccagtcctccccagtgcaccgtctgtgccagggaggccg
gggcaaaggaggccaccgccgccaccgccacccccgccggccctgcccccactgccccca
ctgcccccaccgcctctggaaaagcggagggaccgcagcacaggcctgtgcctccttgtg
ctgtttttcatggttctggtaaccctcgtgggactggggctcgggatgtttcagcttttc
cacctgcagaaggaattggccgaactcagagaggccaccagccaaaggcatgtagcatca
tctttggagaagcaaataggtccctccaatccatcctctgaaaacagggagctgaggaaa
gtggcccatttaacaggcaagcccaacacaagatccatacctctggaatgggaagacacg
tatggaatcaccctggtctctggagtgaagtataagaagggcagccttgtgatcaatgac
acggggctgtactttgtgtattccaaagtgtacttccggggtcagtcctgcaacaactgg
cccctgaaccacaaggtctttatgaggaactctaagtatccccaggacctggtgctgatg
gaggggaagatgatgaattactgcactactggccagatgtgggcccgcagcagctacttg
ggggcagtgttcaatctcaccagtgctgaccacttatatgtcaatgtctctgagctctct
ctggtcaattttgaggaatctaagacatttttcggcttatataagctctaa

DBGET integrated database retrieval system