KEGG   Manis javanica (Malayan pangolin): 108409588Help
Entry
108409588         CDS       T06054                                 

Gene name
ERLIN1
Definition
(RefSeq) erlin-1
  KO
K23341  erlin
Organism
mjv  Manis javanica (Malayan pangolin)
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mjv04121]
    108409588 (ERLIN1)
Ubiquitin system [BR:mjv04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    108409588 (ERLIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 Catalase-rel DUF4346
Motif
Other DBs
NCBI-GeneID: 108409588
NCBI-ProteinID: XP_017535741
Position
Unknown
AA seq 348 aa AA seqDB search
MNMTQARVLVAAVVGLVVILLYASIHKIEEGHLAVYYRGGALLTSPSGPGYHIMLPFITT
FRSVQTTLQTDEVKNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFN
KIHHELNQFCSAHTLQEVYIELFDQIDENLKQALQKDLNIMAPGLTIQAVRVTKPKIPEA
IRRNFELMEAEKTKLLIAAQKQKVVEKEAETERKKAVIEAEKIAQVAKIQFQQKVMEKET
EKRISEIEDAAFLAREKAKADAEYYAAHKYATSNKHKLTPEYLELKRFEAIASNSKIYFG
NNIPSMFVDSSCALKYSDIRTGRKNSLPSKEALEPSGDNPIQNKENTG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgactcaagcccgggttctggtggctgcagtggtgggtctggtggttatcctg
ctttacgcctccatccacaagatcgaggaaggacatctggctgtgtactacaggggagga
gctttactaactagccccagtggaccaggctatcatatcatgttgcctttcattactacg
ttcagatctgtgcagacaacactacaaaccgatgaagttaaaaatgtgccttgtggaacg
agtggtggggtcatgatctatattgaccgaatagaagtggttaatatgttggctccttat
gcagtgtttgatattgtgagaaactacactgcagattatgacaagaccttaattttcaat
aaaatccaccatgaactgaaccaattttgcagtgcccacacgcttcaagaagtttacatt
gagttgtttgatcaaatagatgaaaacctgaagcaagctctgcagaaagatttaaacatc
atggccccaggcctcaccatacaggctgtacgtgttacaaaacccaaaattccagaagcc
ataagaagaaattttgagttaatggaggctgagaagacaaaacttcttatagctgcacag
aaacaaaaggtggtggagaaagaagctgagacagagaggaaaaaggctgttatagaagca
gagaagattgcacaagtggcaaaaattcagtttcagcagaaggtgatggagaaagaaact
gaaaagcgcatttctgaaattgaagatgctgcattcctggcccgagagaaggcaaaagca
gatgctgaatattatgctgcacataaatatgccacctcaaacaagcacaaattgaccccg
gaatatctggagctcaaaaggtttgaagccattgcttctaacagtaagatctactttggc
aacaacatccctagcatgttcgtggactcctcttgtgctttgaaatattcagatattagg
actggaagaaaaaactctctcccctctaaggaggctcttgaaccctctggagacaaccct
atccaaaacaaagagaacacaggttga

DBGET integrated database retrieval system