KEGG   Methanopyrus kandleri: MK0082Help
Entry
MK0082            CDS       T00078                                 

Gene name
porA_1
Definition
(GenBank) Pyruvate:ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mka  Methanopyrus kandleri
Pathway
mka00010  Glycolysis / Gluconeogenesis
mka00020  Citrate cycle (TCA cycle)
mka00620  Pyruvate metabolism
mka00633  Nitrotoluene degradation
mka00640  Propanoate metabolism
mka00650  Butanoate metabolism
mka00680  Methane metabolism
mka00720  Carbon fixation pathways in prokaryotes
mka01100  Metabolic pathways
mka01120  Microbial metabolism in diverse environments
mka01130  Biosynthesis of antibiotics
mka01200  Carbon metabolism
Module
mka_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mka00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MK0082 (porA_1)
   00020 Citrate cycle (TCA cycle)
    MK0082 (porA_1)
   00620 Pyruvate metabolism
    MK0082 (porA_1)
   00640 Propanoate metabolism
    MK0082 (porA_1)
   00650 Butanoate metabolism
    MK0082 (porA_1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MK0082 (porA_1)
   00680 Methane metabolism
    MK0082 (porA_1)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MK0082 (porA_1)
Enzymes [BR:mka01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MK0082 (porA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: AAM01299
UniProt: Q8TZ57
Position
75767..76918
Genome map
AA seq 383 aa AA seqDB search
MTEVHVINGNYAVAEAVRMVDVDVIAAYPITPQTPIVEYLSEFVSNGELDAEFIHVESEH
SAISAVLGASATGARVFTATASQGLALMHEILFIASGLRLPIVMAVANRALSAPINIWCD
HSDSVAQRDTSWIQLYCESNQEVFDTVVQAYRIAEHEDVLLPVMVCLDGFTLSHTLEPVE
LPEEEEVRSFVGKYEPTHCYLDPEDPMTLGPVGGPDSYMEFKKMQHDAMEKAREVIGEVN
REFSDEFGRSYGDGLIEEYNTEDADYVVIAMGSVCGTVKHVIDEERPDVGLVRVKAYRPF
PGDRIVEVIQDKEGVVTIDRAHSYGAMPPLWTDVKAHAPDVDVSSTIAGLGGRDIRPQDV
LEIIKVAEEGKGMDEPVWINVKV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagttcatgtgatcaacgggaattacgccgtagccgaagcggttaggatggtg
gacgtcgacgtcattgcggcgtacccgatcacaccccaaacacccatcgtagaatacctt
tccgagttcgtatctaacggggaactggacgccgagttcatacacgtagagtccgagcac
agcgcgatcagcgccgtgctcggtgcctcggcgactggagcccgcgtgttcactgcgacg
gcgtctcaaggtctcgcccttatgcacgagatcctgttcatcgcttcaggactcaggtta
ccgatcgtgatggccgtcgcgaaccgcgcgctctcagctccgatcaacatctggtgcgat
cactccgactccgtggcgcaacgggacacgtcgtggatccagctgtactgtgagtctaat
caagaggtattcgacaccgtagtgcaagcctaccggatcgcggaacacgaagacgtcctc
ttacccgtgatggtatgcctggacgggttcacgttatcccacaccttggaacccgtcgaa
cttccggaagaggaagaggtacgatcgttcgtcggtaagtacgagccaacccactgttac
ctagaccccgaagacccgatgacgctagggcctgtaggtggccctgacagctacatggag
ttcaagaagatgcagcacgatgcgatggaaaaggcacgtgaggttataggagaggtcaac
agggagttctcggacgagttcgggcgttcctacggtgacgggctaatcgaggagtacaat
acagaggacgctgattacgtggtgatcgcgatgggatccgtctgcgggaccgtcaagcac
gtgatagatgaggagcgcccggacgtgggtctggtcagggtgaaggcttaccgcccgttc
ccaggcgaccggatagtggaggtaatccaggacaaggaaggcgtcgtgactatcgatcgc
gcacattcgtacggggcgatgccgccgctgtggacggacgtcaaagctcacgcaccggac
gtcgacgtatcgtcgaccatcgcgggtctcggtggccgcgacatacgcccacaggacgtg
ctcgagataatcaaggtggcagaggaagggaagggtatggacgaacccgtctggatcaac
gtgaaggtgtga

DBGET integrated database retrieval system